Integrin alpha-L

Details

Name
Integrin alpha-L
Synonyms
  • CD11 antigen-like family member A
  • CD11A
  • Leukocyte adhesion glycoprotein LFA-1 alpha chain
  • Leukocyte function-associated molecule 1 alpha chain
  • LFA-1A
Gene Name
ITGAL
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001030|Integrin alpha-L
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
Number of residues
1170
Molecular Weight
128768.495
Theoretical pI
5.35
GO Classification
Functions
cell adhesion molecule binding / ICAM-3 receptor activity / metal ion binding
Processes
activated T cell proliferation / blood coagulation / cell adhesion / cell-matrix adhesion / extracellular matrix organization / heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules / inflammatory response / integrin-mediated signaling pathway / leukocyte cell-cell adhesion / leukocyte migration / movement of cell or subcellular component / positive regulation of calcium-mediated signaling / positive regulation of T cell proliferation / receptor clustering / regulation of immune response / signal transduction / T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
Components
cell surface / cell-cell junction / external side of plasma membrane / extracellular exosome / immunological synapse / integrin alphaL-beta2 complex / integrin complex / membrane / plasma membrane
General Function
Metal ion binding
Specific Function
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes.
Pfam Domain Function
Transmembrane Regions
1091-1111
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0021647|Integrin alpha-L (ITGAL)
ATGAAGGATTCCTGCATCACTGTGATGGCCATGGCGCTGCTGTCTGGGTTCTTTTTCTTC
GCGCCGGCCTCGAGCTACAACCTGGACGTGCGGGGCGCGCGGAGCTTCTCCCCACCGCGC
GCCGGGAGGCACTTTGGATACCGCGTCCTGCAGGTCGGAAACGGGGTCATCGTGGGAGCT
CCAGGGGAGGGGAACAGCACAGGAAGCCTCTATCAGTGCCAGTCGGGCACAGGACACTGC
CTGCCAGTCACCCTGAGAGGTTCCAACTATACCTCCAAGTACTTGGGAATGACCTTGGCA
ACAGACCCCACAGATGGAAGCATTTTGTTTGCTGCTGTTCAGTTTTCCACAAGCTACAAA
ACAGAATTTGATTTCTCAGATTATGTTAAACGGAAGGACCCTGATGCTCTGCTGAAGCAT
GTAAAGCACATGTTGCTGTTGACCAATACCTTTGGTGCCATCAATTATGTCGCGACAGAG
GTGTTCCGGGAGGAGCTGGGGGCCCGGCCAGATGCCACCAAAGTGCTTATCATCATCACG
GATGGGGAGGCCACTGACAGTGGCAACATCGATGCGGCCAAAGACATCATCCGCTACATC
ATCGGGATTGGAAAGCATTTTCAGACCAAGGAGAGTCAGGAGACCCTCCACAAATTTGCA
TCAAAACCCGCGAGCGAGTTTGTGAAAATTCTGGACACATTTGAGAAGCTGAAAGATCTA
TTCACTGAGCTGCAGAAGAAGATCTATGTCATTGAGGGCACAAGCAAACAGGACCTGACT
TCCTTCAACATGGAGCTGTCCTCCAGCGGCATCAGTGCTGACCTCAGCAGGGGCCATGCA
GTCGTGGGGGCAGTAGGAGCCAAGGACTGGGCTGGGGGCTTTCTTGACCTGAAGGCAGAC
CTGCAGGATGACACATTTATTGGGAATGAACCATTGACACCAGAAGTGAGAGCAGGCTAT
TTGGGTTACACCGTGACCTGGCTGCCCTCCCGGCAAAAGACTTCGTTGCTGGCCTCGGGA
GCCCCTCGATACCAGCACATGGGCCGAGTGCTGCTGTTCCAAGAGCCACAGGGCGGAGGA
CACTGGAGCCAGGTCCAGACAATCCATGGGACCCAGATTGGCTCTTATTTCGGTGGGGAG
CTGTGTGGCGTCGACGTGGACCAAGATGGGGAGACAGAGCTGCTGCTGATTGGTGCCCCA
CTGTTCTATGGGGAGCAGAGAGGAGGCCGGGTGTTTATCTACCAGAGAAGACAGTTGGGG
TTTGAAGAAGTCTCAGAGCTGCAGGGGGACCCCGGCTACCCACTCGGGCGGTTTGGAGAA
GCCATCACTGCTCTGACAGACATCAACGGCGATGGGCTGGTAGACGTGGCTGTGGGGGCC
CCTCTGGAGGAGCAGGGGGCTGTGTACATCTTCAATGGGAGGCACGGGGGGCTTAGTCCC
CAGCCAAGTCAGCGGATAGAAGGGACCCAAGTGCTCTCAGGAATTCAGTGGTTTGGACGC
TCCATCCATGGGGTGAAGGACCTTGAAGGGGATGGCTTGGCAGATGTGGCTGTGGGGGCT
GAGAGCCAGATGATCGTGCTGAGCTCCCGGCCCGTGGTGGATATGGTCACCCTGATGTCC
TTCTCTCCAGCTGAGATCCCAGTGCATGAAGTGGAGTGCTCCTATTCAACCAGTAACAAG
ATGAAAGAAGGAGTTAATATCACAATCTGTTTCCAGATCAAGTCTCTCATCCCCCAGTTC
CAAGGCCGCCTGGTTGCCAATCTCACTTACACTCTGCAGCTGGATGGCCACCGGACCAGA
AGACGGGGGTTGTTCCCAGGAGGGAGACATGAACTCAGAAGGAATATAGCTGTCACCACC
AGCATGTCATGCACTGACTTCTCATTTCATTTCCCGGTATGTGTTCAAGACCTCATCTCC
CCCATCAATGTTTCCCTGAATTTCTCTCTTTGGGAGGAGGAAGGGACACCGAGGGACCAA
AGGGCGGGCAAGGACATACCGCCCATCCTGAGACCCTCCCTGCACTCGGAAACCTGGGAG
ATCCCTTTTGAGAAGAACTGTGGGGAGGACAAGAAGTGTGAGGCAAACTTGAGAGTGTCC
TTCTCTCCTGCAAGATCCAGAGCCCTGCGTCTAACTGCTTTTGCCAGCCTCTCTGTGGAG
CTGAGCCTGAGTAACTTGGAAGAAGATGCTTACTGGGTCCAGCTGGACCTGCACTTCCCC
CCGGGACTCTCCTTCCGCAAGGTGGAGATGCTGAAGCCCCATAGCCAGATACCTGTGAGC
TGCGAGGAGCTTCCTGAAGAGTCCAGGCTTCTGTCCAGGGCATTATCTTGCAATGTGAGC
TCTCCCATCTTCAAAGCAGGCCACTCGGTTGCTCTGCAGATGATGTTTAATACACTGGTA
AACAGCTCCTGGGGGGACTCGGTTGAATTGCACGCCAATGTGACCTGTAACAATGAGGAC
TCAGACCTCCTGGAGGACAACTCAGCCACTACCATCATCCCCATCCTGTACCCCATCAAC
ATCCTCATCCAGGACCAAGAAGACTCCACACTCTATGTCAGTTTCACCCCCAAAGGCCCC
AAGATCCACCAAGTCAAGCACATGTACCAGGTGAGGATCCAGCCTTCCATCCACGACCAC
AACATACCCACCCTGGAGGCTGTGGTTGGGGTGCCACAGCCTCCCAGCGAGGGGCCCATC
ACACACCAGTGGAGCGTGCAGATGGAGCCTCCCGTGCCCTGCCACTATGAGGATCTGGAG
AGGCTCCCGGATGCAGCTGAGCCTTGTCTCCCCGGAGCCCTGTTCCGCTGCCCTGTTGTC
TTCAGGCAGGAGATCCTCGTCCAAGTGATCGGGACTCTGGAGCTGGTGGGAGAGATCGAG
GCCTCTTCCATGTTCAGCCTCTGCAGCTCCCTCTCCATCTCCTTCAACAGCAGCAAGCAT
TTCCACCTCTATGGCAGCAACGCCTCCCTGGCCCAGGTTGTCATGAAGGTTGACGTGGTG
TATGAGAAGCAGATGCTCTACCTCTACGTGCTGAGCGGCATCGGGGGGCTGCTGCTGCTG
CTGCTCATTTTCATAGTGCTGTACAAGGTTGGTTTCTTCAAACGGAACCTGAAGGAGAAG
ATGGAGGCTGGCAGAGGTGTCCCGAATGGAATCCCTGCAGAAGACTCTGAGCAGCTGGCA
TCTGGGCAAGAGGCTGGGGATCCCGGCTGCCTGAAGCCCCTCCATGAGAAGGACTCTGAG
AGTGGTGGTGGCAAGGACTGA
Chromosome Location
16
Locus
16p11.2
External Identifiers
ResourceLink
UniProtKB IDP20701
UniProtKB Entry NameITAL_HUMAN
GenBank Protein ID31422
GenBank Gene IDY00796
GenAtlas IDITGAL
HGNC IDHGNC:6148
General References
  1. Larson RS, Corbi AL, Berman L, Springer T: Primary structure of the leukocyte function-associated molecule-1 alpha subunit: an integrin with an embedded domain defining a protein superfamily. J Cell Biol. 1989 Feb;108(2):703-12. [PubMed:2537322]
  2. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829]
  3. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Shelley CS, Farokhzad OC, Arnaout MA: Identification of cell-specific and developmentally regulated nuclear factors that direct myeloid and lymphoid expression of the CD11a gene. Proc Natl Acad Sci U S A. 1993 Jun 1;90(11):5364-8. [PubMed:8099450]
  6. Nueda A, Lopez-Cabrera M, Vara A, Corbi AL: Characterization of the CD11a (alpha L, LFA-1 alpha) integrin gene promoter. J Biol Chem. 1993 Sep 15;268(26):19305-11. [PubMed:8103515]
  7. Cornwell RD, Gollahon KA, Hickstein DD: Description of the leukocyte function-associated antigen 1 (LFA-1 or CD11a) promoter. Proc Natl Acad Sci U S A. 1993 May 1;90(9):4221-5. [PubMed:8097887]
  8. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973]
  9. Qu A, Leahy DJ: Crystal structure of the I-domain from the CD11a/CD18 (LFA-1, alpha L beta 2) integrin. Proc Natl Acad Sci U S A. 1995 Oct 24;92(22):10277-81. [PubMed:7479767]
  10. Qu A, Leahy DJ: The role of the divalent cation in the structure of the I domain from the CD11a/CD18 integrin. Structure. 1996 Aug 15;4(8):931-42. [PubMed:8805579]
  11. Kallen J, Welzenbach K, Ramage P, Geyl D, Kriwacki R, Legge G, Cottens S, Weitz-Schmidt G, Hommel U: Structural basis for LFA-1 inhibition upon lovastatin binding to the CD11a I-domain. J Mol Biol. 1999 Sep 10;292(1):1-9. [PubMed:10493852]
  12. Shimaoka M, Xiao T, Liu JH, Yang Y, Dong Y, Jun CD, McCormack A, Zhang R, Joachimiak A, Takagi J, Wang JH, Springer TA: Structures of the alpha L I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation. Cell. 2003 Jan 10;112(1):99-111. [PubMed:12526797]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00095Efalizumabapproved, investigationalyesantibodyDetails
DB021771-Acetyl-4-(4-{4-[(2-Ethoxyphenyl)Thio]-3-Nitrophenyl}Pyridin-2-Yl)PiperazineexperimentalunknownDetails
DB03932LFA703experimentalunknownDetails
DB04724(S)-2-((S)-3-isobutyl-2,5-dioxo-4-quinolin-3-ylmethyl-[1,4]diazepan-1yl)-N-methyl-3-naphtalen-2-yl-propionamideexperimentalunknownDetails
DB00227Lovastatinapproved, investigationalunknowninhibitory allosteric modulatorDetails
DB00098Antithymocyte immunoglobulin (rabbit)approvedyesDetails
DB069727A-[(4-cyanophenyl)methyl]-6-(3,5-dichlorophenyl)-5-oxo-2,3,5,7A-tetrahydro-1H-pyrrolo[1,2-A]pyrrole-7-carbonitrileexperimentalunknownDetails
DB074863-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-2,3-bis(trifluoromethyl)phenyl}sulfanyl)anilineexperimentalunknownDetails
DB11611LifitegrastapprovedyesantagonistDetails
DB00641Simvastatinapprovedunknowninhibitory allosteric modulatorDetails
DB01098Rosuvastatinapprovedunknowninhibitory allosteric modulatorDetails
DB08860PitavastatinapprovedunknownDetails