Inosine-5'-monophosphate dehydrogenase 1

Details

Name
Inosine-5'-monophosphate dehydrogenase 1
Synonyms
  • 1.1.1.205
  • IMP dehydrogenase 1
  • IMPD1
  • IMPDH-I
Gene Name
IMPDH1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001518|Inosine-5'-monophosphate dehydrogenase 1
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Number of residues
514
Molecular Weight
55405.365
Theoretical pI
6.9
GO Classification
Functions
DNA binding / IMP dehydrogenase activity / metal ion binding / nucleic acid binding / RNA binding
Processes
GMP biosynthetic process / lymphocyte proliferation / nucleobase-containing small molecule metabolic process / purine nucleobase metabolic process / purine ribonucleoside monophosphate biosynthetic process / response to cold / retina development in camera-type eye / small molecule metabolic process
Components
cell junction / cytoplasm / cytosol / nucleoplasm / nucleus
General Function
Rna binding
Specific Function
Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010537|Inosine-5'-monophosphate dehydrogenase 1 (IMPDH1)
ATGGAGGGGCCACTCACTCCACCACCGCTGCAGGGAGGCGGAGCCGCCGCTGTTCCGGAG
CCCGGAGCCCGGCAACACCCGGGACACGAGACGGCGGCGCAGCGGTACAGCGCCCGACTG
CTGCAGGCCGGCTACGAGCCCGAGAGCCCTAGATTGGACCTCGCTACACACCCGACGACA
CCCCGTTCAGAACTATCTTCAGTGGTCTTACTGGCAGGTGTTGGTGTCCAGATGGATCGC
CTTCGCAGGGCTAGCATGGCGGACTACCTGATCAGCGGCGGCACCGGCTACGTGCCCGAG
GATGGGCTCACCGCGCAGCAGCTCTTCGCCAGCGCCGACGGCCTCACCTACAACGACTTC
CTGATTCTCCCAGGATTCATAGACTTCATAGCTGATGAGGTGGACCTGACCTCAGCCCTG
ACCCGGAAGATCACGCTGAAGACGCCACTGATCTCCTCCCCCATGGACACTGTGACAGAG
GCTGACATGGCCATTGCCATGGCTCTGATGGGAGGTATTGGTTTCATTCACCACAACTGC
ACCCCAGAGTTCCAGGCCAACGAGGTGCGGAAGGTCAAGAAGTTTGAACAGGGCTTCATC
ACGGACCCTGTGGTGCTGAGCCCCTCGCACACTGTGGGCGATGTGCTGGAGGCCAAGATG
CGGCATGGCTTCTCTGGCATCCCCATCACTGAGACGGGCACCATGGGCAGCAAGCTGGTG
GGCATCGTCACCTCCCGAGACATCGACTTTCTTGCTGAGAAGGACCACACCACCCTCCTC
AGTGAGGTGATGACGCCAAGGATTGAACTGGTGGTGGCTCCAGCAGGTGTGACGTTGAAA
GAGGCAAATGAGATCCTGCAGCGTAGCAAGAAAGGGAAGCTGCCTATCGTCAATGATTGC
GATGAGCTGGTGGCCATCATCGCCCGCACCGACCTGAAGAAGAACCGAGACTACCCTCTG
GCCTCCAAGGATTCCCAGAAGCAGCTGCTCTGTGGGGCAGCTGTGGGCACCCGTGAGGAT
GACAAATACCGTCTGGACCTGCTCACCCAGGCGGGCGTCGACGTCATAGTCTTGGACTCG
TCCCAAGGGAATTCGGTGTATCAGATCGCCATGGTGCATTACATCAAACAGAAGTACCCC
CACCTCCAGGTGATTGGGGGGAACGTGGTGACAGCAGCCCAGGCCAAGAACCTGATTGAT
GCTGGTGTGGACGGGCTGCGCGTGGGCATGGGCTGCGGCTCCATCTGCATCACCCAGGAA
GTGATGGCCTGTGGTCGGCCCCAGGGCACTGCTGTGTACAAGGTGGCTGAGTATGCCCGG
CGCTTTGGTGTGCCCATCATAGCCGATGGCGGCATCCAGACCGTGGGACACGTGGTCAAG
GCCCTGGCCCTTGGAGCCTCCACAGTGATGATGGGCTCCCTGCTGGCCGCCACTACGGAG
GCCCCTGGCGAGTACTTCTTCTCAGACGGGGTGCGGCTCAAGAAGTACCGGGGCATGGGC
TCACTGGATGCCATGGAGAAGAGCAGCAGCAGCCAGAAACGATACTTCAGCGAGGGGGAT
AAAGTGAAGATCGCGCAGGGTGTCTCGGGCTCCATCCAGGACAAAGGATCCATTCAGAAG
TTCGTGCCCTACCTCATAGCAGGCATCCAACACGGCTGCCAGGATATCGGGGCCCGCAGC
CTGTCTGTCCTTCGGTCCATGATGTACTCAGGAGAGCTCAAGTTTGAGAAGCGGACCATG
TCGGCCCAGATTGAGGGTGGTGTCCATGGCCTGCACTCTTACGAAAAGCGGCTGTACTGA
Chromosome Location
7
Locus
7q31.3-q32
External Identifiers
ResourceLink
UniProtKB IDP20839
UniProtKB Entry NameIMDH1_HUMAN
GenBank Protein ID307067
GenBank Gene IDJ05272
GenAtlas IDIMPDH1
HGNC IDHGNC:6052
General References
  1. Natsumeda Y, Ohno S, Kawasaki H, Konno Y, Weber G, Suzuki K: Two distinct cDNAs for human IMP dehydrogenase. J Biol Chem. 1990 Mar 25;265(9):5292-5. [PubMed:1969416]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Carr SF, Papp E, Wu JC, Natsumeda Y: Characterization of human type I and type II IMP dehydrogenases. J Biol Chem. 1993 Dec 25;268(36):27286-90. [PubMed:7903306]
  7. Jin P, Fu GK, Wilson AD, Yang J, Chien D, Hawkins PR, Au-Young J, Stuve LL: PCR isolation and cloning of novel splice variant mRNAs from known drug target genes. Genomics. 2004 Apr;83(4):566-71. [PubMed:15028279]
  8. Hager PW, Collart FR, Huberman E, Mitchell BS: Recombinant human inosine monophosphate dehydrogenase type I and type II proteins. Purification and characterization of inhibitor binding. Biochem Pharmacol. 1995 May 11;49(9):1323-9. [PubMed:7763314]
  9. McLean JE, Hamaguchi N, Belenky P, Mortimer SE, Stanton M, Hedstrom L: Inosine 5'-monophosphate dehydrogenase binds nucleic acids in vitro and in vivo. Biochem J. 2004 Apr 15;379(Pt 2):243-51. [PubMed:14766016]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  11. Kennan A, Aherne A, Palfi A, Humphries M, McKee A, Stitt A, Simpson DA, Demtroder K, Orntoft T, Ayuso C, Kenna PF, Farrar GJ, Humphries P: Identification of an IMPDH1 mutation in autosomal dominant retinitis pigmentosa (RP10) revealed following comparative microarray analysis of transcripts derived from retinas of wild-type and Rho(-/-) mice. Hum Mol Genet. 2002 Mar 1;11(5):547-57. [PubMed:11875049]
  12. Bowne SJ, Sullivan LS, Blanton SH, Cepko CL, Blackshaw S, Birch DG, Hughbanks-Wheaton D, Heckenlively JR, Daiger SP: Mutations in the inosine monophosphate dehydrogenase 1 gene (IMPDH1) cause the RP10 form of autosomal dominant retinitis pigmentosa. Hum Mol Genet. 2002 Mar 1;11(5):559-68. [PubMed:11875050]
  13. Bowne SJ, Sullivan LS, Mortimer SE, Hedstrom L, Zhu J, Spellicy CJ, Gire AI, Hughbanks-Wheaton D, Birch DG, Lewis RA, Heckenlively JR, Daiger SP: Spectrum and frequency of mutations in IMPDH1 associated with autosomal dominant retinitis pigmentosa and leber congenital amaurosis. Invest Ophthalmol Vis Sci. 2006 Jan;47(1):34-42. [PubMed:16384941]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00157NADHapproved, nutraceuticalunknownDetails
DB00688Mycophenolate mofetilapproved, investigationalyesinhibitorinducerDetails
DB00811RibavirinapprovedyesinhibitorDetails
DB01024Mycophenolic acidapprovedyesinhibitorDetails
DB039486-Chloropurine Riboside, 5'-MonophosphateexperimentalunknownDetails
DB06103VX-148investigationalunknownDetails
DB06408TaribavirininvestigationalunknownDetails
DB01033MercaptopurineapprovedunknowninhibitorDetails