V-type proton ATPase subunit C 1

Details

Name
V-type proton ATPase subunit C 1
Synonyms
  • ATP6C
  • ATP6D
  • V-ATPase subunit C 1
  • Vacuolar proton pump subunit C 1
  • VATC
Gene Name
ATP6V1C1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017461|V-type proton ATPase subunit C 1
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKAL
RVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
Number of residues
382
Molecular Weight
43941.245
Theoretical pI
Not Available
GO Classification
Functions
hydrogen-exporting ATPase activity, phosphorylative mechanism / proton-transporting ATPase activity, rotational mechanism / transporter activity
Processes
ATP hydrolysis coupled proton transport / cellular iron ion homeostasis / insulin receptor signaling pathway / ion transmembrane transport / phagosome maturation / proton transport / transferrin transport / transmembrane transport
Components
apical part of cell / cytoplasmic vesicle / cytosol / extracellular exosome / lysosomal membrane / plasma membrane / proton-transporting two-sector ATPase complex / proton-transporting V-type ATPase, V1 domain
General Function
Transporter activity
Specific Function
Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017462|V-type proton ATPase subunit C 1 (ATP6V1C1)
ATGACTGAGTTCTGGCTTATATCTGCTCCTGGGGAGAAAACCTGTCAGCAAACATGGGAG
AAATTGCATGCGGCAACTTCAAAGAACAATAATCTTGCTGTCACTTCCAAGTTCAATATT
CCTGACTTAAAGGTTGGCACGTTGGATGTCTTGGTTGGCTTGTCAGATGAACTGGCTAAA
CTGGATGCATTTGTAGAAGGAGTGGTTAAGAAAGTAGCTCAATACATGGCTGATGTATTG
GAAGATAGCAAAGACAAAGTTCAAGAGAATCTGTTGGCTAATGGAGTGGACTTGGTTACT
TATATAACAAGGTTCCAGTGGGACATGGCCAAATATCCAATCAAGCAGTCCCTGAAAAAT
ATTTCTGAAATAATTGCCAAGGGAGTAACTCAGATTGATAATGACCTGAAATCTCGAGCA
TCTGCATACAATAACCTGAAAGGAAATCTTCAGAATTTGGAACGAAAGAATGCAGGAAGT
TTGCTAACTAGAAGTCTAGCAGAAATTGTGAAGAAGGATGACTTTGTTCTTGATTCAGAG
TATCTCGTCACATTACTGGTAGTAGTTCCCAAGTTAAACCACAACGACTGGATTAAGCAG
TATGAAACACTAGCCGAAATGGTAGTTCCAAGGTCTAGCAATGTTCTTTCAGAGGACCAA
GACAGTTACCTGTGTAATGTCACCTTGTTTAGGAAGGCAGTTGATGACTTCAGACACAAA
GCCAGAGAAAACAAATTCATTGTTCGTGACTTCCAGTATAATGAAGAGGAGATGAAAGCA
GATAAAGAAGAAATGAACAGGCTTTCTACTGATAAGAAAAAACAATTTGGACCACTTGTA
CGGTGGCTGAAAGTGAATTTTAGTGAAGCATTTATTGCATGGATTCACGTGAAAGCATTA
CGGGTTTTCGTTGAGTCTGTTTTAAGGTATGGCTTGCCAGTGAACTTCCAAGCAATGCTA
CTTCAGCCCAATAAGAAAACTTTGAAGAAACTGAGAGAAGTATTACATGAATTGTATAAA
CATCTAGACAGCAGTGCAGCAGCTATTATTGATGCTCCTATGGATATTCCAGGTTTAAAC
CTGAGTCAACAAGAATACTACCCCTATGTGTACTACAAGATTGATTGCAACTTGCTGGAA
TTCAAGTGA
Chromosome Location
8
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP21283
UniProtKB Entry NameVATC1_HUMAN
HGNC IDHGNC:856
General References
  1. van Hille B, Vanek M, Richener H, Green JR, Bilbe G: Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase. Biochem Biophys Res Commun. 1993 Nov 30;197(1):15-21. [PubMed:8250920]
  2. Tanner SM, Austin JL, Leone G, Rush LJ, Plass C, Heinonen K, Mrozek K, Sill H, Knuutila S, Kolitz JE, Archer KJ, Caligiuri MA, Bloomfield CD, de La Chapelle A: BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia. Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13901-6. Epub 2001 Nov 13. [PubMed:11707601]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Nelson H, Mandiyan S, Noumi T, Moriyama Y, Miedel MC, Nelson N: Molecular cloning of cDNA encoding the C subunit of H(+)-ATPase from bovine chromaffin granules. J Biol Chem. 1990 Nov 25;265(33):20390-3. [PubMed:2147024]
  5. Smith AN, Borthwick KJ, Karet FE: Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis. Gene. 2002 Sep 4;297(1-2):169-77. [PubMed:12384298]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  7. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [PubMed:22223895]
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  9. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01694D-tartaric acidexperimentalunknownDetails
DB09552ThonzoniumapprovedyesinhibitorDetails
DB01133Tiludronic acidapproved, investigational, vet_approvedunknowninhibitorDetails