Spermidine/spermine N(1)-acetyltransferase

Details

Name
Spermidine/spermine N(1)-acetyltransferase
Synonyms
  • Protease synthase and sporulation negative regulatory protein PAI 1
  • SAT
  • Spermidine N(1)-acetyltransferase
  • SSAT
Gene Name
paiA
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0011222|Spermidine/spermine N(1)-acetyltransferase
MSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQ
FFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIAL
ERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLI
Number of residues
172
Molecular Weight
20014.605
Theoretical pI
4.95
GO Classification
Functions
diamine N-acetyltransferase activity
Processes
negative regulation of sporulation / sporulation resulting in formation of a cellular spore
General Function
Diamine n-acetyltransferase activity
Specific Function
Involved in the protection against polyamine toxicity by regulating their concentration. Also could be involved in the negative control of sporulation as well as production of degradative enzymes such as alpha-amylase, levansucrase and alkaline phosphatase. Catalyzes the transfer of an acetyl group from acetyl coenzyme A (AcCoA) to an acceptor substrate and releases both CoA and the acetylated product. It possesses N1-acetyltransferase activity toward polyamine substrates including spermidine, spermine, aminopropylcadaverine, norspermidine, homospermidine, N(8)-acetylspermidine, diaminopropane and agmatine.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011223|Spermidine/spermine N(1)-acetyltransferase (paiA)
ATGAGTGTAAAAATGAAAAAATGCAGCCGGGAAGATTTACAAACACTTCAACAATTGAGT
ATTGAAACATTCAATGACACTTTTAAAGAACAGAACTCACCTGAAAATATGAAAGCCTAT
TTAGAAAGCGCATTTAACACTGAGCAGCTGGAAAAAGAGTTATCTAATATGTCTTCGCAA
TTCTTTTTTATTTACTTTGATCATGAAATCGCTGGATATGTAAAGGTCAATATCGATGAT
GCTCAGTCTGAAGAAATGGGTGCTGAATCACTTGAAATCGAGAGAATTTATATAAAGAAC
AGCTTTCAAAAACATGGGCTTGGCAAACATCTGCTGAATAAAGCGATAGAAATTGCGCTG
GAACGTAATAAAAAGAACATTTGGCTAGGTGTGTGGGAAAAAAATGAAAATGCCATTGCC
TTTTATAAGAAAATGGGGTTTGTTCAGACCGGCGCCCACTCATTTTATATGGGTGATGAA
GAACAAACGGATTTAATCATGGCTAAAACACTCATATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP21340
UniProtKB Entry NamePAIA_BACSU
GenBank Protein ID143284
GenBank Gene IDM36471
General References
  1. Honjo M, Nakayama A, Fukazawa K, Kawamura K, Ando K, Hori M, Furutani Y: A novel Bacillus subtilis gene involved in negative control of sporulation and degradative-enzyme production. J Bacteriol. 1990 Apr;172(4):1783-90. [Article]
  2. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
  3. Forouhar F, Lee IS, Vujcic J, Vujcic S, Shen J, Vorobiev SM, Xiao R, Acton TB, Montelione GT, Porter CW, Tong L: Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase. J Biol Chem. 2005 Dec 2;280(48):40328-36. Epub 2005 Oct 6. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01992Coenzyme Ainvestigational, nutraceuticalunknownDetails
DB044471,4-DithiothreitolexperimentalunknownDetails