Uroporphyrinogen-III C-methyltransferase

Details

Name
Uroporphyrinogen-III C-methyltransferase
Synonyms
  • 2.1.1.107
  • SUMT
  • Urogen III methylase
  • UROM
  • Uroporphyrinogen III methylase
Gene Name
cobA
Organism
Pseudomonas denitrificans
Amino acid sequence
>lcl|BSEQ0019298|Uroporphyrinogen-III C-methyltransferase
MIDDLFAGLPALEKGSVWLVGAGPGDPGLLTLHAANALRQADVIVHDALVNEDCLKLARP
GAVLEFAGKRGGKPSPKQRDISLRLVELARAGNRVLRLKGGDPFVFGRGGEEALTLVEHQ
VPFRIVPGITAGIGGLAYAGIPVTHREVNHAVTFLTGHDSSGLVPDRINWQGIASGSPVI
VMYMAMKHIGAITANLIAGGRSPDEPVAFVCNAATPQQAVLETTLARAEADVAAAGLEPP
AIVVVGEVVRLRAALDWIGALDGRKLAADPFANRILRNPA
Number of residues
280
Molecular Weight
29252.515
Theoretical pI
7.22
GO Classification
Functions
precorrin-2 dehydrogenase activity / uroporphyrin-III C-methyltransferase activity
Processes
cobalamin biosynthetic process / siroheme biosynthetic process
General Function
Uroporphyrin-iii c-methyltransferase activity
Specific Function
Catalyzes the methylation of both C-2 and C-7 of uroporphyrinogen III leading to precorrin-1 and precorrin-2; their oxidative esterification gives respectively factor I octamethyl ester and sirohydrochlorin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0004964|843 bp
ATGATCGACGACCTCTTTGCCGGATTGCCGGCGCTCGAAAAAGGTTCGGTCTGGCTGGTC
GGCGCCGGCCCCGGCGATCCCGGCCTGTTGACGCTGCATGCGGCCAATGCGCTGCGCCAG
GCGGATGTGATCGTGCATGATGCGCTGGTCAACGAGGATTGCCTGAAGCTCGCGCGGCCG
GGCGCCGTGCTGGAGTTTGCGGGCAAGCGTGGCGGCAAGCCGTCGCCGAAGCAGCGCGAC
ATCTCGCTTCGCCTCGTCGAACTCGCGCGCGCCGGCAACCGGGTGCTGCGCCTCAAAGGC
GGCGATCCCTTCGTCTTCGGTCGCGGTGGCGAGGAGGCGCTGACGCTGGTCGAACACCAG
GTGCCGTTCCGAATCGTGCCCGGCATCACCGCCGGTATCGGCGGGCTTGCCTATGCCGGC
ATTCCCGTGACCCATCGCGAGGTCAACCACGCGGTCACTTTCCTGACTGGCCATGATTCC
TCCGGCCTGGTGCCGGATCGCATCAACTGGCAGGGCATCGCCAGCGGCTCGCCTGTCATC
GTCATGTACATGGCGATGAAACATATCGGCGCGATCACCGCCAACCTCATTGCCGGCGGC
CGCTCGCCGGACGAACCGGTCGCCTTCGTCTGCAACGCCGCGACGCCGCAGCAGGCGGTG
CTGGAAACGACGCTTGCGCGTGCAGAGGCCGATGTTGCGGCGGCAGGGCTGGAGCCGCCG
GCGATCGTCGTCGTCGGCGAGGTGGTGCGGCTGCGCGCAGCGCTCGACTGGATCGGCGCG
CTGGACGGGCGCAAGCTTGCCGCCGACCCGTTCGCCAATCGCATTCTCAGGAACCCGGCA
TGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP21631
UniProtKB Entry NameSUMT_PSEDE
GenBank Gene IDM59236
General References
  1. Crouzet J, Cauchois L, Blanche F, Debussche L, Thibaut D, Rouyez MC, Rigault S, Mayaux JF, Cameron B: Nucleotide sequence of a Pseudomonas denitrificans 5.4-kilobase DNA fragment containing five cob genes and identification of structural genes encoding S-adenosyl-L-methionine: uroporphyrinogen III methyltransferase and cobyrinic acid a,c-diamide synthase. J Bacteriol. 1990 Oct;172(10):5968-79. [PubMed:2211520]
  2. Blanche F, Debussche L, Thibaut D, Crouzet J, Cameron B: Purification and characterization of S-adenosyl-L-methionine: uroporphyrinogen III methyltransferase from Pseudomonas denitrificans. J Bacteriol. 1989 Aug;171(8):4222-31. [PubMed:2546914]
  3. Vevodova J, Graham RM, Raux E, Schubert HL, Roper DI, Brindley AA, Ian Scott A, Roessner CA, Stamford NP, Elizabeth Stroupe M, Getzoff ED, Warren MJ, Wilson KS: Structure/function studies on a S-adenosyl-L-methionine-dependent uroporphyrinogen III C methyltransferase (SUMT), a key regulatory enzyme of tetrapyrrole biosynthesis. J Mol Biol. 2004 Nov 19;344(2):419-33. [PubMed:15522295]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails