D(1A) dopamine receptor

Details

Name
D(1A) dopamine receptor
Synonyms
  • Dopamine D1 receptor
Gene Name
DRD1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021252|D(1A) dopamine receptor
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Number of residues
446
Molecular Weight
49292.765
Theoretical pI
8.34
GO Classification
Functions
dopamine binding / dopamine neurotransmitter receptor activity / dopamine neurotransmitter receptor activity, coupled via Gs / drug binding / G-protein coupled amine receptor activity
Processes
activation of adenylate cyclase activity / adenylate cyclase-activating dopamine receptor signaling pathway / adenylate cyclase-activating G-protein coupled receptor signaling pathway / adult walking behavior / astrocyte development / behavioral fear response / behavioral response to cocaine / calcium-mediated signaling / cellular response to catecholamine stimulus / cellular response to hypoxia / cellular response to insulin stimulus / cerebral cortex GABAergic interneuron migration / conditioned taste aversion / dentate gyrus development / dopamine metabolic process / dopamine transport / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / glucose import / grooming behavior / habituation / learning / long term synaptic depression / long-term synaptic potentiation / maternal behavior / mating behavior / memory / negative regulation of cell migration / negative regulation of circadian sleep/wake cycle, sleep / negative regulation of protein kinase activity / neuronal action potential / operant conditioning / orbitofrontal cortex development / peristalsis / phospholipase C-activating dopamine receptor signaling pathway / positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway / positive regulation of cAMP biosynthetic process / positive regulation of cell migration / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of feeding behavior / positive regulation of long-term synaptic potentiation / positive regulation of membrane potential / positive regulation of potassium ion transport / positive regulation of release of sequestered calcium ion into cytosol / positive regulation of synaptic transmission, glutamatergic / prepulse inhibition / protein import into nucleus / regulation of dopamine metabolic process / regulation of dopamine uptake involved in synaptic transmission / regulation of long-term neuronal synaptic plasticity / regulation of vasoconstriction / response to activity / response to amino acid / response to amphetamine / response to antidepressant / response to drug / response to estradiol / response to ethanol / response to food / response to morphine / response to nicotine / response to retinoic acid / sensitization / sensory perception of chemical stimulus / social behavior / striatum development / synapse assembly / synaptic transmission, dopaminergic / temperature homeostasis / transmission of nerve impulse / vasodilation / visual learning
Components
axon terminus / caveola / ciliary membrane / cytosol / dendritic shaft / dendritic spine head / dendritic spine neck / endoplasmic reticulum membrane / integral component of plasma membrane / neuronal cell body / nonmotile primary cilium / nucleus / plasma membrane
General Function
G-protein coupled amine receptor activity
Specific Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Pfam Domain Function
Transmembrane Regions
24-49 61-87 97-119 139-163 193-218 273-299 313-337
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021253|D(1A) dopamine receptor (DRD1)
ATGAGGACTCTGAACACCTCTGCCATGGACGGGACTGGGCTGGTGGTGGAGAGGGACTTC
TCTGTTCGTATCCTCACTGCCTGTTTCCTGTCGCTGCTCATCCTGTCCACGCTCCTGGGG
AACACGCTGGTCTGTGCTGCCGTTATCAGGTTCCGACACCTGCGGTCCAAGGTGACCAAC
TTCTTTGTCATCTCCTTGGCTGTGTCAGATCTCTTGGTGGCCGTCCTGGTCATGCCCTGG
AAGGCAGTGGCTGAGATTGCTGGCTTCTGGCCCTTTGGGTCCTTCTGTAACATCTGGGTG
GCCTTTGACATCATGTGCTCCACTGCATCCATCCTCAACCTCTGTGTGATCAGCGTGGAC
AGGTATTGGGCTATCTCCAGCCCTTTCCGGTATGAGAGAAAGATGACCCCCAAGGCAGCC
TTCATCCTGATCAGTGTGGCATGGACCTTGTCTGTACTCATCTCCTTCATCCCAGTGCAG
CTCAGCTGGCACAAGGCAAAACCCACAAGCCCCTCTGATGGAAATGCCACTTCCCTGGCT
GAGACCATAGACAACTGTGACTCCAGCCTCAGCAGGACATATGCCATCTCATCCTCTGTA
ATAAGCTTTTACATCCCTGTGGCCATCATGATTGTCACCTACACCAGGATCTACAGGATT
GCTCAGAAACAAATACGGCGCATTGCGGCCTTGGAGAGGGCAGCAGTCCACGCCAAGAAT
TGCCAGACCACCACAGGTAATGGAAAGCCTGTCGAATGTTCTCAACCGGAAAGTTCTTTT
AAGATGTCCTTCAAAAGAGAAACTAAAGTCCTGAAGACTCTGTCGGTGATCATGGGTGTG
TTTGTGTGCTGTTGGCTACCTTTCTTCATCTTGAACTGCATTTTGCCCTTCTGTGGGTCT
GGGGAGACGCAGCCCTTCTGCATTGATTCCAACACCTTTGACGTGTTTGTGTGGTTTGGG
TGGGCTAATTCATCCTTGAACCCCATCATTTATGCCTTTAATGCTGATTTTCGGAAGGCA
TTTTCAACCCTCTTAGGATGCTACAGACTTTGCCCTGCGACGAATAATGCCATAGAGACG
GTGAGTATCAATAACAATGGGGCCGCGATGTTTTCCAGCCATCATGAGCCACGAGGCTCC
ATCTCCAAGGAGTGCAATCTGGTTTACCTGATCCCACATGCTGTGGGCTCCTCTGAGGAC
CTGAAAAAGGAGGAGGCAGCTGGCATCGCCAGACCCTTGGAGAAGCTGTCCCCAGCCCTA
TCAGTCATATTGGACTATGACACTGACGTCTCTCTGGAGAAGATCCAACCCATCACACAA
AACGGTCAGCACCCAACCTGA
Chromosome Location
5
Locus
5q35.1
External Identifiers
ResourceLink
UniProtKB IDP21728
UniProtKB Entry NameDRD1_HUMAN
GenBank Protein ID30397
GenBank Gene IDX55760
GenAtlas IDDRD1
HGNC IDHGNC:3020
General References
  1. Dearry A, Gingrich JA, Falardeau P, Fremeau RT Jr, Bates MD, Caron MG: Molecular cloning and expression of the gene for a human D1 dopamine receptor. Nature. 1990 Sep 6;347(6288):72-6. [PubMed:2144334]
  2. Zhou QY, Grandy DK, Thambi L, Kushner JA, Van Tol HH, Cone R, Pribnow D, Salon J, Bunzow JR, Civelli O: Cloning and expression of human and rat D1 dopamine receptors. Nature. 1990 Sep 6;347(6288):76-80. [PubMed:2168520]
  3. Sunahara RK, Niznik HB, Weiner DM, Stormann TM, Brann MR, Kennedy JL, Gelernter JE, Rozmahel R, Yang YL, Israel Y, et al.: Human dopamine D1 receptor encoded by an intronless gene on chromosome 5. Nature. 1990 Sep 6;347(6288):80-3. [PubMed:1975640]
  4. Ohara K, Ulpian C, Seeman P, Sunahara RK, Van Tol HH, Niznik HB: Schizophrenia: dopamine D1 receptor sequence is normal, but has DNA polymorphisms. Neuropsychopharmacology. 1993 Feb;8(2):131-5. [PubMed:8471124]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Jin H, Xie Z, George SR, O'Dowd BF: Palmitoylation occurs at cysteine 347 and cysteine 351 of the dopamine D(1) receptor. Eur J Pharmacol. 1999 Dec 15;386(2-3):305-12. [PubMed:10618483]
  8. Bevilacqua L, Doly S, Kaprio J, Yuan Q, Tikkanen R, Paunio T, Zhou Z, Wedenoja J, Maroteaux L, Diaz S, Belmer A, Hodgkinson CA, Dell'osso L, Suvisaari J, Coccaro E, Rose RJ, Peltonen L, Virkkunen M, Goldman D: A population-specific HTR2B stop codon predisposes to severe impulsivity. Nature. 2010 Dec 23;468(7327):1061-6. doi: 10.1038/nature09629. [PubMed:21179162]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00353MethylergometrineapprovedyesantagonistDetails
DB00508Triflupromazineapproved, vet_approvedyesantagonistDetails
DB00589Lisurideapproved, investigationalunknownantagonistDetails
DB00805MinaprineapprovedunknownagonistDetails
DB00850PerphenazineapprovedyesantagonistDetails
DB00988DopamineapprovedyesagonistDetails
DB01235LevodopaapprovedyesagonistDetails
DB01239Chlorprothixeneapproved, experimental, investigational, withdrawnyesantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00372Thiethylperazineapproved, withdrawnunknownantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00800FenoldopamapprovedyesagonistDetails
DB00875Flupentixolapproved, investigational, withdrawnyesantagonistDetails
DB01063AcetophenazineapprovedyesantagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01624Zuclopenthixolapproved, investigationalyesantagonistDetails
DB00363ClozapineapprovedunknownantagonistDetails
DB00623FluphenazineapprovedyesantagonistDetails
DB00502HaloperidolapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownantagonistDetails
DB01038CarphenazinewithdrawnyesantagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB05271RotigotineapprovedunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovedunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalunknownantagonistpartial agonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01608Periciazineapproved, investigationalyesantagonistDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownpartial agonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB01614Acepromazineexperimental, vet_approvedyesantagonistDetails
DB01621Pipotiazineapproved, investigationalyesantagonistDetails
DB01622ThioproperazineexperimentalunknownantagonistDetails
DB01623ThiothixeneapprovedyesantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB12890DihydrexidineinvestigationalunknownDetails
DB12093TetrahydropalmatineinvestigationalunknownantagonistDetails
DB09286PipamperoneinvestigationalunknownantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownbinderDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00248CabergolineapprovedunknownagonistDetails
DB00988DopamineapprovedunknownagonistDetails
DB00696ErgotamineapprovedunknownagonistDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB09097Quinagolideapproved, investigationalunknownagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB09225Zotepineapproved, investigational, withdrawnyesantagonistDetails
DB11584PipradrolapprovedunknownagonistDetails
DB11274Dihydro-alpha-ergocryptineapprovedyespartial agonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11275EpicriptineapprovedyesagonistDetails