Esterase

Details

Name
Esterase
Synonyms
  • 3.1.1.-
Gene Name
estA
Organism
Streptomyces scabiei
Amino acid sequence
>lcl|BSEQ0003758|Esterase
MSSAMRKTTNSPVVRRLTAAAVALGSCLALAGPAGSAGAAPADPVPTVFFGDSYTANFGI
APVTNQDSERGWCFQAKENYPAVATRSLADKGITLDVQADVSCGGALIHHFWEKQELPFG
AGELPPQQDALKQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKC
GEFFGTGDGKQWLDDQFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAA
PGQTQLPFADIPQDALPVLDQIQKRLNDAMKKAAADGGADFVDLYAGTGANTACDGADRG
IGGLLEDSQLELLGTKIPWYAHPNDKGRDIQAKQVADKIEEILNR
Number of residues
345
Molecular Weight
36669.83
Theoretical pI
4.46
GO Classification
Functions
carboxylic ester hydrolase activity
Components
extracellular region
General Function
Carboxylic ester hydrolase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0003757|1038 bp
ATGTCTTCGGCCATGCGTAAGACGACGAATTCTCCGGTGGTACGGCGGCTGACCGCCGCG
GCCGTCGCACTGGGCAGCTGCCTGGCGCTGGCCGGTCCGGCGGGAAGCGCGGGCGCGGCG
CCCGCCGACCCCGTACCGACCGTCTTCTTCGGCGACTCCTACACCGCCAACTTCGGCATC
GCTCCCGTGACCAACCAGGACAGCGAGAGGGGCTGGTGTTTCCAGGCGAAGGAGAACTAT
CCCGCCGTCGCCACCCGGAGCCTGGCCGACAAGGGCATCACGCTCGACGTCCAGGCGGAC
GTCTCCTGCGGAGGCGCGCTCATCCACCACTTCTGGGAGAAGCAGGAGCTGCCCTTCGGC
GCCGGCGAGCTCCCGCCGCAGCAGGACGCGCTCAAGCAGGACACCCAGCTGACCGTGGGA
AGCCTGGGCGGCAACACACTGGGTTTCAACCGCATCCTGAAGCAGTGTTCCGACGAGCTC
CGGAAGCCCTCTCTGCTGCCGGGAGACCCGGTGGACGGGGACGAGCCGGCCGCCAAGTGC
GGTGAGTTCTTCGGGACCGGGGACGGAAAGCAGTGGCTGGACGACCAGTTCGAGCGGGTC
GGTGCGGAGCTGGAGGAGCTGCTCGACCGCATCGGCTACTTCGCCCCCGACGCCAAGCGC
GTCCTGGTCGGCTACCCCCGGCTCGTGCCCGAGGACACCACCAAGTGCCTGACCGCGGCG
CCCGGTCAGACGCAACTGCCGTTCGCCGACATCCCCCAGGACGCCCTGCCGGTCCTGGAC
CAGATCCAGAAGCGGCTGAACGATGCCATGAAGAAGGCCGCCGCCGACGGCGGCGCCGAC
TTCGTCGACCTCTACGCCGGCACCGGCGCCAACACGGCGTGCGACGGCGCCGACCGGGGC
ATCGGCGGCCTGCTGGAGGACTCCCAGCTCGAACTCCTCGGCACCAAGATCCCCTGGTAC
GCGCACCCCAATGACAAGGGCCGCGACATCCAGGCCAAGCAGGTGGCCGACAAGATCGAG
GAGATCCTCAACCGGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP22266
UniProtKB Entry NameESTA_STRSC
GenBank Protein ID153255
GenBank Gene IDM57297
General References
  1. Raymer G, Willard JM, Schottel JL: Cloning, sequencing, and regulation of expression of an extracellular esterase gene from the plant pathogen Streptomyces scabies. J Bacteriol. 1990 Dec;172(12):7020-6. [PubMed:2254271]
  2. Schottel JL, Hale V, Babcock MJ: Regulation and secretion of an extracellular esterase from Streptomyces scabies. Gene. 1992 Jun 15;115(1-2):27-31. [PubMed:1612447]
  3. Wei Y, Schottel JL, Derewenda U, Swenson L, Patkar S, Derewenda ZS: A novel variant of the catalytic triad in the Streptomyces scabies esterase. Nat Struct Biol. 1995 Mar;2(3):218-23. [PubMed:7773790]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02845Methylphosphinic AcidexperimentalunknownDetails