Amicyanin
Details
- Name
- Amicyanin
- Synonyms
- ami
- Gene Name
- mauC
- Organism
- Paracoccus denitrificans
- Amino acid sequence
>lcl|BSEQ0011934|Amicyanin MISATKIRSCLAACVLAAFGATGALADKATIPSESPFAAAEVADGAIVVDIAKMKYETPE LHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTP HPFMRGKVVVE
- Number of residues
- 131
- Molecular Weight
- 13983.11
- Theoretical pI
- 6.67
- GO Classification
- Functionscopper ion binding / electron carrier activityProcessesoxidation-reduction processComponentsperiplasmic space
- General Function
- Electron carrier activity
- Specific Function
- Primary acceptor of electrons from methylamine dehydrogenase. Passes those electrons on either a soluble cytochrome c or to pseudoazurin.
- Pfam Domain Function
- Copper-bind (PF00127)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
>lcl|BSEQ0005382|396 bp ATGATTTCTGCGACCAAGATCCGCTCGTGCCTGGCGGCCTGCGTCCTGGCGGCATTCGGC GCGACGGGCGCCCTGGCCGACAAGGCGACGATCCCCTCGGAAAGCCCCTTTGCCGCCGCC GAGGTGGCCGATGGCGCCATCGTCGTCGACATCGCCAAGATGAAATACGAAACCCCCGAA CTTCATGTGAAGGTCGGCGACACCGTCACCTGGATCAACCGCGAGGCGATGCCGCACAAT GTCCATTTCGTCGCCGGCGTGCTGGGCGAGGCGGCGTTGAAAGGCCCGATGATGAAGAAG GAGCAGGCCTATTCCCTGACCTTCACCGAGGCCGGCACCTATGACTATCACTGCACCCCG CATCCCTTCATGCGCGGCAAGGTCGTCGTCGAGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P22364 UniProtKB Entry Name AMCY_PARDE GenBank Gene ID X55665 - General References
- van Spanning RJ, Wansell CW, Reijnders WN, Oltmann LF, Stouthamer AH: Mutagenesis of the gene encoding amicyanin of Paracoccus denitrificans and the resultant effect on methylamine oxidation. FEBS Lett. 1990 Nov 26;275(1-2):217-20. [Article]
- Husain M, Davidson VL, Smith AJ: Properties of Paracoccus denitrificans amicyanin. Biochemistry. 1986 May 6;25(9):2431-6. [Article]
- Chen L, Durley R, Poliks BJ, Hamada K, Chen Z, Mathews FS, Davidson VL, Satow Y, Huizinga E, Vellieux FM, et al.: Crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin. Biochemistry. 1992 Jun 2;31(21):4959-64. [Article]
- Chen L, Durley RC, Mathews FS, Davidson VL: Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i. Science. 1994 Apr 1;264(5155):86-90. [Article]
- Cunane LM, Chen ZW, Durley RC, Mathews FS: X-ray structure of the cupredoxin amicyanin, from Paracoccus denitrificans, refined at 1.31 A resolution. Acta Crystallogr D Biol Crystallogr. 1996 Jul 1;52(Pt 4):676-86. [Article]
- Zhu Z, Cunane LM, Chen Z, Durley RC, Mathews FS, Davidson VL: Molecular basis for interprotein complex-dependent effects on the redox properties of amicyanin. Biochemistry. 1998 Dec 8;37(49):17128-36. [Article]