Cholesterol oxidase

Details

Name
Cholesterol oxidase
Synonyms
  • 1.1.3.6
  • CHOD
  • Cholesterol isomerase
Gene Name
choB
Organism
Brevibacterium sterolicum
Amino acid sequence
>lcl|BSEQ0010856|Cholesterol oxidase
MTDSRANRADATRGVASVSRRRFLAGAGLTAGAIALSSMSTSASAAPSRTLADGDRVPAL
VIGSGYGGAVAALRLTQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADKTDQ
PVSNFMGFGINKSIDRYVGVLDSERFSGIKVYQGRGVGGGSLVNGGMAVTPKRNYFEEIL
PSVDSNEMYNKYFPRANTGLGVNNIDQAWFESTEWYKFARTGRKTAQRSGFTTAFVPNVY
DFEYMKKEAAGQVTKSGLGGEVIYGNNAGKKSLDKTYLAQAAATGKLTITTLHRVTKVAP
ATGSGYSVTMEQIDEQGNVVATKVVTADRVFFAAGSVGTSKLLVSMKAQGHLPNLSSQVG
EGWGNNGNIMVGRANHMWDATGSKQATIPTMGIDNWADPTAPIFAEIAPLPAGLETYVSL
YLAITKNPERARFQFNSGTGKVDLTWAQSQNQKGIDMAKKVFDKINQKEGTIYRTDLFGV
YFKTWGDDFTYHPLGGVLLNKATDNFGRLPEYPGLYVVDGSLVPGNVGVNPFVTITRLAE
RNMDKIISSDIQ
Number of residues
552
Molecular Weight
59357.765
Theoretical pI
9.73
GO Classification
Functions
cholesterol oxidase activity / flavin adenine dinucleotide binding / steroid delta-isomerase activity
Processes
cholesterol metabolic process
Components
extracellular region
General Function
Steroid delta-isomerase activity
Specific Function
Catalyzes the oxidation and isomerization of cholesterol to cholestenone (4-cholesten-3-one), which is an initial step in the cholesterol degradation process.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0002448|1659 bp
ATGACCGATAGCCGGGCGAACAGAGCCGATGCGACTCGGGGGGTTGCATCCGTCTCACGC
CGTCGATTCCTTGCGGGCGCAGGTCTGACCGCGGGAGCCATCGCGCTCTCGTCGATGTCG
ACCTCCGCCTCCGCAGCCCCCAGCCGCACCCTCGCCGACGGCGACCGCGTCCCTGCCCTC
GTCATCGGCAGTGGATACGGCGGTGCCGTCGCCGCGCTGCGGCTGACGCAGGCCGGTATC
CCCACGCAGATCGTCGAGATGGGCCGCAGCTGGGACACCCCGGGCTCCGACGGCAAGATC
TTCTGCGGGATGCTCAACCCCGACAAGCGCTCGATGTGGTTGGCCGACAAGACCGATCAG
CCGGTCAGCAACTTCATGGGCTTCGGCATCAACAAGAGCATCGACCGGTACGTCGGCGTC
CTCGACTCCGAGCGGTTCTCCGGCATCAAGGTCTACCAGGGCCGCGGCGTCGGCGGCGGC
TCGCTCGTCAACGGCGGTATGGCAGTCACCCCGAAGCGCAACTACTTCGAGGAGATCCTG
CCGTCGGTCGACTCGAACGAGATGTACAACAAGTACTTCCCGCGCGCCAACACCGGTCTG
GGTGTCAACAACATCGACCAGGCGTGGTTCGAGTCCACCGAGTGGTACAAGTTCGCCCGC
ACCGGCCGCAAGACCGCCCAACGTTCGGGTTTCACAACCGCTTTCGTGCCCAACGTGTAC
GACTTCGAGTACATGAAGAAGGAGGCTGCCGGCCAGGTCACCAAGTCGGGCCTCGGCGGT
GAGGTCATCTACGGCAACAACGCCGGCAAGAAGTCGCTCGACAAGACCTACCTCGCGCAG
GCCGCGGCCACCGGGAAGCTGACGATCACGACTTTGCACCGCGTCACCAAGGTCGCGCCG
GCCACCGGCAGCGGCTACAGCGTGACGATGGAACAGATCGACGAGCAGGGCAACGTCGTC
GCCACCAAGGTCGTCACCGCCGATCGGGTGTTCTTCGCGGCCGGCAGCGTCGGCACCAGC
AAGCTCCTGGTCTCGATGAAGGCGCAGGGCCACCTGCCGAACCTGTCGTCGCAGGTCGGC
GAGGGCTGGGGCAACAACGGCAACATCATGGTGGGCCGCGCGAACCACATGTGGGACGCC
ACCGGATCCAAGCAGGCCACCATCCCGACGATGGGAATCGACAACTGGGCCGACCCGACG
GCACCGATCTTCGCGGAGATCGCCCCGCTGCCGGCCGGGCTCGAGACCTACGTCAGCCTG
TACCTGGCCATCACGAAGAACCCCGAACGTGCTCGCTTCCAGTTCAATTCGGGCACCGGC
AAGGTCGATCTCACCTGGGCTCAGTCGCAGAACCAGAAGGGCATCGACATGGCCAAGAAG
GTGTTCGACAAGATCAACCAGAAGGAGGGCACCATCTACCGCACCGATCTGTTCGGTGTC
TACTTCAAGACCTGGGGCGACGACTTCACGTACCACCCGCTGGGCGGCGTGCTGCTGAAC
AAGGCGACCGACAACTTTGGCCGCTTGCCCGAGTACCCCGGCCTGTACGTGGTGGACGGC
TCGCTCGTCCCCGGCAATGTGGGCGTCAACCCGTTCGTCACGATCACCCGGCTCGCCGAG
CGCAACATGGACAAGATCATCTCGTCCGACATCCAGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP22637
UniProtKB Entry NameCHOD_BREST
GenBank Protein ID216385
GenBank Gene IDD00712
General References
  1. Ohta T, Fujishiro K, Yamaguchi K, Tamura Y, Aisaka K, Uwajima T, Hasegawa M: Sequence of gene choB encoding cholesterol oxidase of Brevibacterium sterolicum: comparison with choA of streptomyces sp. SA-COO. Gene. 1991 Jul 15;103(1):93-6. [PubMed:1879703]
  2. Fujishiro K, Ohta T, Hasegawa M, Yamaguchi K, Mizukami T, Uwajima T, Ota T: Isolation and identification of the gene of cholesterol oxidase from Brevibacterium sterolicum ATCC 21387, a widely used enzyme in clinical analysis. Biochem Biophys Res Commun. 1990 Oct 30;172(2):721-7. [PubMed:2271066]
  3. Vrielink A, Lloyd LF, Blow DM: Crystal structure of cholesterol oxidase from Brevibacterium sterolicum refined at 1.8 A resolution. J Mol Biol. 1991 Jun 5;219(3):533-54. [PubMed:2051487]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownsubstrateDetails