Carboxypeptidase N subunit 2

Details

Name
Carboxypeptidase N subunit 2
Synonyms
  • ACBP
  • Carboxypeptidase N 83 kDa chain
  • Carboxypeptidase N large subunit
  • Carboxypeptidase N polypeptide 2
  • Carboxypeptidase N regulatory subunit
Gene Name
CPN2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017125|Carboxypeptidase N subunit 2
MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETS
FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNL
TSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNL
LAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQL
FCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQ
LETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALFQNL
SKLELLSLSKNQLTTLPEGIFDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNI
QTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQ
CTYSNPEGTVVLACDQAQCRWLNVQLSPQQGSLGLQYNASQEWDLRSSCGSLRLTVSIEA
RAAGP
Number of residues
545
Molecular Weight
60556.01
Theoretical pI
5.89
GO Classification
Functions
enzyme regulator activity
Processes
protein stabilization / regulation of catalytic activity
Components
blood microparticle / extracellular exosome / extracellular region
General Function
Enzyme regulator activity
Specific Function
The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017126|Carboxypeptidase N subunit 2 (CPN2)
ATGCTCCCTGGAGCCTGGCTGCTCTGGACCTCCCTCCTGCTCCTGGCCAGGCCTGCCCAG
CCCTGTCCCATGGGTTGTGACTGCTTCGTCCAGGAGGTGTTCTGCTCAGATGAGGAGCTT
GCCACCGTCCCACTGGACATCCCGCCATATACGAAAAACATCATCTTTGTGGAGACCTCG
TTCACCACATTGGAAACCAGAGCTTTTGGCAGTAACCCCAACTTGACCAAGGTGGTCTTC
CTCAACACTCAGCTCTGCCAGTTTAGGCCGGATGCCTTCGGGGGGCTGCCCAGGCTGGAG
GACCTGGAGGTCACAGGCAGTAGCTTCTTGAACCTCAGCACCAACATCTTCTCCAACCTG
ACCTCGCTGGGCAAGCTCACCCTCAACTTCAACATGCTGGAGGCTCTGCCCGAGGGTCTT
TTCCAGCACCTGGCTGCCCTGGAGTCCCTCCACCTGCAGGGGAACCAGCTCCAGGCCCTG
CCCAGGAGGCTCTTCCAGCCTCTGACCCATCTGAAGACACTCAACCTGGCCCAGAACCTC
CTGGCCCAGCTCCCGGAGGAGCTGTTCCACCCACTCACCAGCCTGCAGACCCTGAAGCTG
AGCAACAACGCGCTCTCTGGTCTCCCCCAGGGTGTGTTTGGCAAACTGGGCAGCCTGCAG
GAGCTCTTCCTGGACAGCAACAACATCTCGGAGCTGCCCCCTCAGGTGTTCTCCCAGCTC
TTCTGCCTAGAGAGGCTGTGGCTGCAACGCAACGCCATCACGCACCTGCCGCTCTCCATC
TTTGCCTCCCTGGGTAATCTGACCTTTCTGAGCTTGCAGTGGAACATGCTTCGGGTCCTG
CCTGCCGGCCTCTTTGCCCACACCCCGTGCCTGGTTGGCCTGTCTCTGACCCATAACCAG
CTGGAGACTGTCGCTGAGGGCACCTTTGCCCACCTGTCCAACCTGCGTTCCCTCATGCTC
TCATACAATGCCATTACCCACCTCCCAGCTGGCATCTTCAGAGACCTGGAGGAGTTGGTC
AAACTCTACCTGGGCAGCAACAACCTTACGGCGCTGCACCCAGCCCTCTTCCAGAACCTG
TCCAAGCTGGAGCTGCTCAGCCTCTCCAAGAACCAGCTGACCACACTTCCGGAGGGCATC
TTCGACACCAACTACAACCTGTTCAACCTGGCCCTGCACGGTAACCCCTGGCAGTGCGAC
TGCCACCTGGCCTACCTCTTCAACTGGCTGCAGCAGTACACCGATCGGCTCCTGAACATC
CAGACCTACTGCGCTGGCCCTGCCTACCTCAAAGGCCAGGTGGTGCCCGCCTTGAATGAG
AAGCAGCTGGTGTGTCCCGTCACCCGGGACCACTTGGGCTTCCAGGTCACGTGGCCGGAC
GAAAGCAAGGCAGGGGGCAGCTGGGATCTGGCTGTGCAGGAAAGGGCAGCCCGGAGCCAG
TGCACCTACAGCAACCCCGAGGGCACCGTGGTGCTCGCCTGTGACCAGGCCCAGTGTCGC
TGGCTGAACGTCCAGCTCTCTCCTCAGCAGGGCTCCCTGGGACTGCAGTACAATGCTAGT
CAGGAGTGGGACCTGAGGTCGAGCTGCGGTTCTCTGCGGCTCACCGTGTCTATCGAGGCT
CGGGCAGCAGGGCCCTAG
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP22792
UniProtKB Entry NameCPN2_HUMAN
GenBank Gene IDBC042334
GenAtlas IDCPN2
HGNC IDHGNC:2313
General References
  1. Tan F, Weerasinghe DK, Skidgel RA, Tamei H, Kaul RK, Roninson IB, Schilling JW, Erdos EG: The deduced protein sequence of the human carboxypeptidase N high molecular weight subunit reveals the presence of leucine-rich tandem repeats. J Biol Chem. 1990 Jan 5;265(1):13-9. [PubMed:2378615]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Skidgel RA, Bennett CD, Schilling JW, Tan FL, Weerasinghe DK, Erdos EG: Amino acid sequence of the N-terminus and selected tryptic peptides of the active subunit of human plasma carboxypeptidase N: comparison with other carboxypeptidases. Biochem Biophys Res Commun. 1988 Aug 15;154(3):1323-9. [PubMed:3408501]
  5. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718]
  6. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12271ORE-1001investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails