Xylose isomerase

Details

Name
Xylose isomerase
Synonyms
  • 5.3.1.5
Gene Name
xylA
Organism
Streptomyces rubiginosus
Amino acid sequence
>lcl|BSEQ0022417|Xylose isomerase
MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIP
FGSSDSEREEHVKRFRQALDDTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTI
RNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVW
ASAAGCMRNYLILKERAAAFRADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEF
DVDAAAARGMAFERLDQLAMDHLLGARG
Number of residues
388
Molecular Weight
43226.915
Theoretical pI
4.78
GO Classification
Functions
magnesium ion binding / xylose isomerase activity
Processes
D-xylose metabolic process / pentose-phosphate shunt
Components
cytoplasm
General Function
Xylose isomerase activity
Specific Function
Involved in D-xylose catabolism.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0002438|1167 bp
ATGAACTACCAGCCCACCCCCGAGGACAGGTTCACCTTCGGACTGTGGACCGTCGGCTGG
CAGGGACGGGACCCCTTCGGTGACGCCACGCGGCGCGCCCTCGACCCGGTCGAGTCGGTG
CGGCGGCTGGCCGAGCTGGGCGCCCACGGCGTCACGTTCCACGACGACGACCTCATCCCC
TTCGGCTCCAGCGACAGCGAGCGCGAGGAGCACGTCAAGCGGTTCCGGCAGGCGCTGGAC
GACACCGGCATGAAGGTGCCGATGGCCACCACCAACCTGTTCACCCACCCGGTGTTCAAG
GACGGCGGCTTCACCGCCAACGACCGCGACGTGCGCCGCTACGCCCTGCGCAAGACCATC
CGCAACATCGACCTCGCGGTCGAGCTCGGCGCCGAGACCTATGTGGCCTGGGGCGGCCGC
GAGGGTGCCGAGTCGGGTGGCGCCAAGGACGTGCGGGACGCCCTCGACCGCATGAAGGAG
GCCTTCGACCTGCTCGGCGAGTACGTCACCTCCCAGGGCTACGACATCCGCTTCGCCATC
GAGCCCAAGCCGAACGAGCCGCGCGGCGACATCCTGCTCCCCACCGTCGGCCACGCCCTG
GCGTTCATCGAGCGCCTGGAGCGACCGGAGCTGTACGGCGTGAACCCCGAGGTCGGCCAC
GAGCAGATGGCCGGGCTGAACTTCCCGCACGGCATCGCGCAGGCGCTGTGGGCGGGCAAG
CTGTTCCACATCGACCTCAACGGCCAGAACGGCATCAAGTACGACCAGGACCTCCGCTTC
GGCGCGGGCGACCTGCGGGCCGCGTTCTGGCTGGTGGACCTGCTGGAGTCGGCCGGCTAC
AGCGGCCCGCGGCACTTCGACTTCAAGCCGCCGCGGACCGAGGACTTCGACGGGGTGTGG
GCCTCGGCGGCCGGCTGCATGCGCAACTACCTGATCCTCAAGGAGCGTGCGGCGGCCTTC
CGCGCCGACCCCGAGGTGCAGGAGGCGCTGCGCGCGTCCCGTCTGGACGAGCTGGCCCGG
CCCACGGCGGCCGACGGTCTGCAGGCCCTGCTCGACGACCGGTCCGCCTTCGAGGAGTTC
GACGTCGACGCGGCGGCGGCCCGTGGGATGGCCTTCGAGCGCCTGGACCAGCTGGCGATG
GACCACCTGCTGGGCGCCCGGGGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP24300
UniProtKB Entry NameXYLA_STRRU
GenBank Protein ID153534
GenBank Gene IDM73789
General References
  1. Wong HC, Ting Y, Lin HC, Reichert F, Myambo K, Watt KW, Toy PL, Drummond RJ: Genetic organization and regulation of the xylose degradation genes in Streptomyces rubiginosus. J Bacteriol. 1991 Nov;173(21):6849-58. [PubMed:1657868]
  2. Carrell HL, Glusker JP, Burger V, Manfre F, Tritsch D, Biellmann JF: X-ray analysis of D-xylose isomerase at 1.9 A: native enzyme in complex with substrate and with a mechanism-designed inactivator. Proc Natl Acad Sci U S A. 1989 Jun;86(12):4440-4. [PubMed:2734296]
  3. Whitlow M, Howard AJ, Finzel BC, Poulos TL, Winborne E, Gilliland GL: A metal-mediated hydride shift mechanism for xylose isomerase based on the 1.6 A Streptomyces rubiginosus structures with xylitol and D-xylose. Proteins. 1991;9(3):153-73. [PubMed:2006134]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01638SorbitolapprovedunknownDetails
DB018812-Methylpentane-1,2,4-TriolexperimentalunknownDetails
DB11195Xylitolexperimental, investigationalunknownDetails
DB03564(4r)-2-Methylpentane-2,4-DiolexperimentalunknownDetails
DB03911L-XylopyranoseexperimentalunknownDetails
DB03947D-XyluloseexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB00126Ascorbic acidapproved, nutraceuticalunknownDetails