Nitrite reductase

Details

Name
Nitrite reductase
Synonyms
  • 1.7.2.1
  • Cytochrome cd1
  • Cytochrome oxidase
  • Hydroxylamine reductase
Gene Name
nirS
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Amino acid sequence
>lcl|BSEQ0016537|Nitrite reductase
MPFGKPLVGTLLASLTLLGLATAHAKDDMKAAEQYQGAASAVDPAHVVRTNGAPDMSESE
FNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLEALITYGTPLGMPNWGSSG
ELSKEQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPEDRPKKQLNDLDLPNLFSVTL
RDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYLLVIGRDARIDMIDLWAKEPTKV
AEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFAIMDGETLEPKQIVSTRGMTVDTQT
YHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNYKDIDNLTVTSIGAAPFLHDGGWDSSH
RYFMTAANNSNKVAVIDSKDRRLSALVDVGKTPHPGRGANFVHPKYGPVWSTSHLGDGSI
SLIGTDPKNHPQYAWKKVAELQGQGGGSLFIKTHPKSSHLYVDTTFNPDARISQSVAVFD
LKNLDAKYQVLPIAEWADLGEGAKRVVQPEYNKRGDEVWFSVWNGKNDSSALVVVDDKTL
KLKAVVKDPRLITPTGKFNVYNTQHDVY
Number of residues
568
Molecular Weight
62652.855
Theoretical pI
8.21
GO Classification
Functions
electron carrier activity / heme binding / hydroxylamine reductase activity / metal ion binding / nitrite reductase (NO-forming) activity
Components
periplasmic space
General Function
Nitrite reductase (no-forming) activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0016538|Nitrite reductase (nirS)
ATGCCATTTGGCAAGCCACTGGTGGGCACCTTGCTCGCCTCGCTGACGCTGCTGGGCCTG
GCCACCGCTCACGCCAAGGACGACATGAAAGCCGCCGAGCAATACCAGGGTGCCGCTTCC
GCCGTCGATCCCGCTCACGTGGTGCGCACCAACGGTGCCCCCGACATGAGTGAAAGCGAG
TTCAACGAGGCCAAGCAGATCTACTTCCAACGCTGCGCCGGTTGCCACGGCGTCCTGCGC
AAGGGCGCCACCGGCAAGCCGCTGACCCCGGACATCACCCAGCAACGCGGCCAGCAATAC
CTGGAAGCGCTGATCACCTACGGCACCCCGCTGGGCATGCCGAACTGGGGCAGCTCCGGC
GAGCTGAGCAAGGAACAGATCACCCTGATGGCCAAGTACATCCAGCACACCCCGCCGCAA
CCGCCGGAGTGGGGCATGCCGGAGATGCGCGAATCGTGGAAGGTGCTGGTGAAGCCGGAG
GACCGGCCGAAGAAACAGCTCAACGACCTCGACCTGCCCAACCTGTTCTCGGTGACCCTG
CGCGACGCCGGGCAGATCGCCCTGGTCGACGGCGACAGCAAGAAGATCGTCAAGGTCATC
GATACCGGCTATGCCGTGCATATCTCGCGGATGTCCGCTTCCGGCCGCTACCTGCTGGTG
ATCGGCCGCGACGCGCGGATCGACATGATCGACCTGTGGGCCAAGGAGCCGACCAAGGTC
GCCGAGATCAAGATCGGCATCGAGGCGCGCTCGGTGGAAAGCTCCAAGTTCAAGGGCTAC
GAGGACCGCTACACCATCGCCGGCGCCTACTGGCCGCCGCAGTTCGCGATCATGGACGGC
GAGACCCTGGAACCGAAGCAGATCGTCTCCACCCGCGGCATGACCGTAGACACCCAGACC
TACCACCCGGAACCGCGCGTGGCGGCGATCATCGCCTCCCACGAGCACCCCGAGTTCATC
GTCAACGTGAAGGAGACCGGCAAGGTCCTGCTGGTCAACTACAAGGATATCGACAACCTC
ACCGTCACCAGCATCGGTGCGGCGCCGTTCCTCCACGACGGCGGCTGGGACAGCAGCCAC
CGCTACTTCATGACCGCCGCCAACAACTCCAACAAGGTTGCCGTGATCGACTCCAAGGAC
CGTCGCCTGTCGGCCCTGGTCGACGTCGGCAAGACCCCGCACCCGGGGCGTGGCGCCAAC
TTCGTGCATCCCAAGTACGGCCCGGTGTGGAGCACCAGCCACCTGGGCGACGGCAGCATC
TCGCTGATCGGCACCGATCCGAAGAACCATCCGCAGTACGCCTGGAAGAAAGTCGCCGAA
CTACAGGGCCAGGGCGGCGGCTCGCTGTTCATCAAGACCCATCCGAAGTCCTCGCACCTC
TACGTCGACACCACCTTCAACCCCGACGCCAGGATCAGCCAGAGCGTCGCGGTGTTCGAC
CTGAAGAACCTCGACGCCAAGTACCAGGTGCTGCCGATCGCCGAATGGGCCGATCTCGGC
GAAGGCGCCAAGCGGGTGGTGCAGCCCGAGTACAACAAGCGCGGCGATGAAGTCTGGTTC
TCGGTGTGGAACGGCAAGAACGACAGCTCCGCGCTGGTGGTGGTGGACGACAAGACCCTG
AAGCTCAAGGCCGTGGTCAAGGACCCGCGGCTGATCACCCCGACCGGTAAGTTCAACGTC
TACAACACCCAGCACGACGTGTACTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP24474
UniProtKB Entry NameNIRS_PSEAE
GenBank Protein ID45358
GenBank Gene IDX16452
General References
  1. Silvestrini MC, Galeotti CL, Gervais M, Schinina E, Barra D, Bossa F, Brunori M: Nitrite reductase from Pseudomonas aeruginosa: sequence of the gene and the protein. FEBS Lett. 1989 Aug 28;254(1-2):33-8. [PubMed:2506077]
  2. Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ, Lagrou M, Garber RL, Goltry L, Tolentino E, Westbrock-Wadman S, Yuan Y, Brody LL, Coulter SN, Folger KR, Kas A, Larbig K, Lim R, Smith K, Spencer D, Wong GK, Wu Z, Paulsen IT, Reizer J, Saier MH, Hancock RE, Lory S, Olson MV: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen. Nature. 2000 Aug 31;406(6799):959-64. [PubMed:10984043]
  3. Arai H, Sanbongi Y, Igarashi Y, Kodama T: Cloning and sequencing of the gene encoding cytochrome c-551 from Pseudomonas aeruginosa. FEBS Lett. 1990 Feb 12;261(1):196-8. [PubMed:2155133]
  4. Nordling M, Young S, Karlsson BG, Lundberg LG: The structural gene for cytochrome c551 from Pseudomonas aeruginosa. The nucleotide sequence shows a location downstream of the nitrite reductase gene. FEBS Lett. 1990 Jan 1;259(2):230-2. [PubMed:2152881]
  5. Nurizzo D, Silvestrini MC, Mathieu M, Cutruzzola F, Bourgeois D, Fulop V, Hajdu J, Brunori M, Tegoni M, Cambillau C: N-terminal arm exchange is observed in the 2.15 A crystal structure of oxidized nitrite reductase from Pseudomonas aeruginosa. Structure. 1997 Sep 15;5(9):1157-71. [PubMed:9331415]
  6. Nurizzo D, Cutruzzola F, Arese M, Bourgeois D, Brunori M, Cambillau C, Tegoni M: Conformational changes occurring upon reduction and NO binding in nitrite reductase from Pseudomonas aeruginosa. Biochemistry. 1998 Oct 6;37(40):13987-96. [PubMed:9760233]
  7. Nurizzo D, Cutruzzola F, Arese M, Bourgeois D, Brunori M, Cambillau C, Tegoni M: Does the reduction of c heme trigger the conformational change of crystalline nitrite reductase? J Biol Chem. 1999 May 21;274(21):14997-5004. [PubMed:10329702]
  8. Cutruzzola F, Brown K, Wilson EK, Bellelli A, Arese M, Tegoni M, Cambillau C, Brunori M: The nitrite reductase from Pseudomonas aeruginosa: essential role of two active-site histidines in the catalytic and structural properties. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2232-7. [PubMed:11226222]
  9. Brown K, Roig-Zamboni V, Cutruzzola' F, Arese M, Sun W, Brunori M, Cambillau C, Tegoni M: Domain swing upon His to Ala mutation in nitrite reductase of Pseudomonas aeruginosa. J Mol Biol. 2001 Sep 21;312(3):541-54. [PubMed:11563915]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails
DB03469Heme DexperimentalunknownDetails