Alpha-1D adrenergic receptor

Details

Name
Alpha-1D adrenergic receptor
Synonyms
  • ADRA1A
  • Alpha-1A adrenergic receptor
  • Alpha-1D adrenoceptor
  • Alpha-1D adrenoreceptor
  • Alpha-adrenergic receptor 1a
Gene Name
ADRA1D
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019001|Alpha-1D adrenergic receptor
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Number of residues
572
Molecular Weight
60462.205
Theoretical pI
9.44
GO Classification
Functions
alpha1-adrenergic receptor activity
Processes
adenylate cyclase-activating adrenergic receptor signaling pathway / adenylate cyclase-modulating G-protein coupled receptor signaling pathway / cell proliferation / cell-cell signaling / DNA metabolic process / G-protein coupled receptor signaling pathway / multicellular organismal development / negative regulation of the force of heart contraction involved in baroreceptor response to increased systemic arterial blood pressure / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of cell proliferation / positive regulation of cytosolic calcium ion concentration / positive regulation of smooth muscle contraction / positive regulation of vasoconstriction
Components
cytosol / integral component of plasma membrane / plasma membrane
General Function
Alpha1-adrenergic receptor activity
Specific Function
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Pfam Domain Function
Transmembrane Regions
96-121 134-159 170-192 214-238 252-275 349-373 381-405
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019002|Alpha-1D adrenergic receptor (ADRA1D)
ATGACTTTCCGCGATCTCCTGAGCGTCAGTTTCGAGGGACCCCGCCCGGACAGCAGCGCA
GGGGGCTCCAGCGCGGGCGGCGGCGGGGGCAGCGCGGGCGGCGCGGCCCCCTCGGAGGGC
CCGGCGGTGGGCGGCGTGCCGGGGGGCGCGGGCGGCGGCGGCGGCGTGGTGGGCGCAGGC
AGCGGCGAGGACAACCGGAGCTCCGCGGGGGAGCCGGGGAGCGCGGGCGCGGGCGGCGAC
GTGAATGGCACGGCGGCCGTCGGGGGACTGGTGGTGAGCGCGCAGGGCGTGGGCGTGGGC
GTCTTCCTGGCAGCCTTCATCCTTATGGCCGTGGCAGGTAACCTGCTTGTCATCCTCTCA
GTGGCCTGCAACCGCCACCTGCAGACCGTCACCAACTATTTCATCGTGAACCTGGCCGTG
GCCGACCTGCTGCTGAGCGCCACCGTACTGCCCTTCTCGGCCACCATGGAGGTTCTGGGC
TTCTGGGCCTTTGGCCGCGCCTTCTGCGACGTATGGGCCGCCGTGGACGTGCTGTGCTGC
ACGGCCTCCATCCTCAGCCTCTGCACCATCTCCGTGGACCGGTACGTGGGCGTGCGCCAC
TCACTCAAGTACCCAGCCATCATGACCGAGCGCAAGGCGGCCGCCATCCTGGCCCTGCTC
TGGGTCGTAGCCCTGGTGGTGTCCGTAGGGCCCCTGCTGGGCTGGAAGGAGCCCGTGCCC
CCTGACGAGCGCTTCTGCGGTATCACCGAGGAGGCGGGCTACGCTGTCTTCTCCTCCGTG
TGCTCCTTCTACCTGCCCATGGCGGTCATCGTGGTCATGTACTGCCGCGTGTACGTGGTC
GCGCGCAGCACCACGCGCAGCCTCGAGGCGGGCGTCAAGCGCGAGCGAGGCAAGGCCTCC
GAGGTGGTGCTGCGCATCCACTGTCGCGGCGCGGCCACGGGCGCCGACGGGGCGCACGGC
ATGCGCAGCGCCAAGGGCCACACCTTCCGCAGCTCGCTCTCCGTGCGCCTGCTCAAGTTC
TCCCGTGAGAAGAAAGCGGCCAAGACTCTGGCCATCGTCGTGGGTGTCTTCGTGCTCTGC
TGGTTCCCTTTCTTCTTTGTCCTGCCGCTCGGCTCCTTGTTCCCGCAGCTGAAGCCATCG
GAGGGCGTCTTCAAGGTCATCTTCTGGCTCGGCTACTTCAACAGCTGCGTGAACCCGCTC
ATCTACCCCTGTTCCAGCCGCGAGTTCAAGCGCGCCTTCCTCCGTCTCCTGCGCTGCCAG
TGCCGTCGTCGCCGGCGCCGCCGCCCTCTCTGGCGTGTCTACGGCCACCACTGGCGGGCC
TCCACCAGCGGCCTGCGCCAGGACTGCGCCCCGAGTTCGGGCGACGCGCCCCCCGGAGCG
CCGCTGGCCCTCACCGCGCTCCCCGACCCCGACCCCGAACCCCCAGGCACGCCCGAGATG
CAGGCTCCGGTCGCCAGCCGTCGAAAGCCACCCAGCGCCTTCCGCGAGTGGAGGCTGCTG
GGGCCGTTCCGGAGACCCACGACCCAGCTGCGCGCCAAAGTCTCCAGCCTGTCGCACAAG
ATCCGCGCCGGGGGCGCGCAGCGCGCAGAGGCAGCGTGCGCCCAGCGCTCAGAGGTGGAG
GCTGTGTCCCTAGGCGTCCCACACGAGGTGGCCGAGGGCGCCACCTGCCAGGCCTACGAA
TTGGCCGACTACAGCAACCTACGGGAGACCGATATTTAA
Chromosome Location
20
Locus
20p13
External Identifiers
ResourceLink
UniProtKB IDP25100
UniProtKB Entry NameADA1D_HUMAN
GenBank Protein ID177807
GenBank Gene IDM76446
GenAtlas IDADRA1D
HGNC IDHGNC:280
General References
  1. Bruno JF, Whittaker J, Song JF, Berelowitz M: Molecular cloning and sequencing of a cDNA encoding a human alpha 1A adrenergic receptor. Biochem Biophys Res Commun. 1991 Sep 30;179(3):1485-90. [PubMed:1656955]
  2. Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed:8183249]
  3. Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed:7815325]
  4. Weinberg DH, Trivedi P, Tan CP, Mitra S, Perkins-Barrow A, Borkowski D, Strader CD, Bayne M: Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c. Biochem Biophys Res Commun. 1994 Jun 30;201(3):1296-304. [PubMed:8024574]
  5. Esbenshade TA, Hirasawa A, Tsujimoto G, Tanaka T, Yano J, Minneman KP, Murphy TJ: Cloning of the human alpha 1d-adrenergic receptor and inducible expression of three human subtypes in SK-N-MC cells. Mol Pharmacol. 1995 May;47(5):977-85. [PubMed:7746284]
  6. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00298DapiprazoleapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00706Tamsulosinapproved, investigationalunknownantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00590DoxazosinapprovedyesantagonistDetails
DB01162TerazosinapprovedyesantagonistDetails
DB00346Alfuzosinapproved, investigationalyesantagonistDetails
DB04855DronedaroneapprovedunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownDetails
DB05469R450investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06207SilodosinapprovedunknownantagonistDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00457PrazosinapprovedyesantagonistDetails
DB00388PhenylephrineapprovedyesDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00696Ergotamineapprovedyespartial agonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB00668Epinephrineapproved, vet_approvedunknownantagonistDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00575ClonidineapprovedunknownagonistDetails
DB00800FenoldopamapprovedunknowninhibitorDetails
DB00248CabergolineapprovedunknownbinderDetails
DB00211MidodrineapprovedunknownagonistDetails
DB00723Methoxamineapproved, investigationalunknownbinderDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB09202Cirazolineexperimentalyespartial agonistDetails
DB00692PhentolamineapprovedunknownantagonistDetails
DB00908Quinidineapproved, investigationalunknownantagonistDetails
DB00661VerapamilapprovedunknownantagonistDetails
DB11124RacepinephrineapprovedyesantagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00370MirtazapineapprovedunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB08922PerospironeexperimentalunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB00841DobutamineapprovedyesagonistDetails
DB09203SynephrineexperimentalunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB09286PipamperoneinvestigationalunknownantagonistDetails
DB00243Ranolazineapproved, investigationalnoantagonistDetails
DB00457PrazosinapprovedunknownDetails
DB00697Tizanidineapproved, investigationalunknownagonistDetails
DB00433Prochlorperazineapproved, vet_approvedunknownantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229AranidipineexperimentalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB00268Ropiniroleapproved, investigationalunknownantagonistDetails