Light-harvesting protein B-800/850 alpha chain
Details
- Name
- Light-harvesting protein B-800/850 alpha chain
- Synonyms
- Antenna pigment protein alpha chain
- Gene Name
- Not Available
- Organism
- Rhodoblastus acidophilus
- Amino acid sequence
>lcl|BSEQ0017267|Light-harvesting protein B-800/850 alpha chain MNQGKIWTVVNPAIGIPALLGSVTVIAILVHLAILSHTTWFPAYWQGGVKKAA
- Number of residues
- 53
- Molecular Weight
- 5653.73
- Theoretical pI
- 10.64
- GO Classification
- Functionsbacteriochlorophyll binding / electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity / metal ion bindingProcessesphotosynthesis, light reaction / protein-chromophore linkageComponentsintegral component of membrane / organelle inner membrane / plasma membrane / plasma membrane light-harvesting complex
- General Function
- Metal ion binding
- Specific Function
- Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers.
- Pfam Domain Function
- LHC (PF00556)
- Transmembrane Regions
- 14-34
- Cellular Location
- Cell inner membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P26789 UniProtKB Entry Name LHA4_RHOAC - General References
- Bissig I, Brunisholz RA, Suter F, Cogdell RJ, Zuber H: The complete amino acid sequences of the B800-850 antenna polypeptides from Rhodopseudomonas acidophila strain 7750. Z Naturforsch C. 1988 Jan-Feb;43(1-2):77-83. [Article]
- Freer A, Prince S, Sauer K, Papiz M, Hawthornthwaite-Lawless A, McDermott G, Cogdell R, Isaacs NW: Pigment-pigment interactions and energy transfer in the antenna complex of the photosynthetic bacterium Rhodopseudomonas acidophila. Structure. 1996 Apr 15;4(4):449-62. [Article]
- Prince SM, Papiz MZ, Freer AA, McDermott G, Hawthornthwaite-Lawless AM, Cogdell RJ, Isaacs NW: Apoprotein structure in the LH2 complex from Rhodopseudomonas acidophila strain 10050: modular assembly and protein pigment interactions. J Mol Biol. 1997 May 2;268(2):412-23. [Article]