5-hydroxytryptamine receptor 2A

Details

Name
5-hydroxytryptamine receptor 2A
Synonyms
  • 5-HT-2
  • HTR2
  • Serotonin receptor 2A
Gene Name
HTR2A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000899|5-hydroxytryptamine receptor 2A
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Number of residues
471
Molecular Weight
52602.58
Theoretical pI
7.72
GO Classification
Functions
1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding / drug binding / serotonin binding / serotonin receptor activity / virus receptor activity
Processes
activation of phospholipase C activity / aging / artery smooth muscle contraction / behavioral response to cocaine / cell death / cellular calcium ion homeostasis / detection of mechanical stimulus involved in sensory perception of pain / detection of temperature stimulus involved in sensory perception of pain / memory / negative regulation of potassium ion transport / negative regulation of synaptic transmission, glutamatergic / phosphatidylinositol 3-kinase signaling / phospholipase C-activating serotonin receptor signaling pathway / positive regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of fat cell differentiation / positive regulation of glycolytic process / positive regulation of MAP kinase activity / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of phosphatidylinositol biosynthetic process / positive regulation of vasoconstriction / protein localization to cytoskeleton / regulation of behavior / regulation of dopamine secretion / regulation of hormone secretion / release of sequestered calcium ion into cytosol / response to drug / serotonin receptor signaling pathway / sleep / synaptic transmission / temperature homeostasis / urinary bladder smooth muscle contraction
Components
axon / caveola / cell body fiber / cytoplasmic membrane-bounded vesicle / cytosol / dendritic shaft / integral component of plasma membrane / neuronal cell body / plasma membrane
General Function
Virus receptor activity
Specific Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.(Microbial infection) Acts as a receptor for human JC polyomavirus/JCPyV.
Pfam Domain Function
Transmembrane Regions
76-99 111-132 149-171 192-215 234-254 325-346 363-384
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020465|5-hydroxytryptamine receptor 2A (HTR2A)
ATGGATATTCTTTGTGAAGAAAATACTTCTTTGAGCTCAACTACGAACTCCCTAATGCAA
TTAAATGATGACACCAGGCTCTACAGTAATGACTTTAACTCCGGAGAAGCTAACACTTCT
GATGCATTTAACTGGACAGTCGACTCTGAAAATCGAACCAACCTTTCCTGTGAAGGGTGC
CTCTCACCGTCGTGTCTCTCCTTACTTCATCTCCAGGAAAAAAACTGGTCTGCTTTACTG
ACAGCCGTAGTGATTATTCTAACTATTGCTGGAAACATACTCGTCATCATGGCAGTGTCC
CTAGAGAAAAAGCTGCAGAATGCCACCAACTATTTCCTGATGTCACTTGCCATAGCTGAT
ATGCTGCTGGGTTTCCTTGTCATGCCCGTGTCCATGTTAACCATCCTGTATGGGTACCGG
TGGCCTCTGCCGAGCAAGCTTTGTGCAGTCTGGATTTACCTGGACGTGCTCTTCTCCACG
GCCTCCATCATGCACCTCTGCGCCATCTCGCTGGACCGCTACGTCGCCATCCAGAATCCC
ATCCACCACAGCCGCTTCAACTCCAGAACTAAGGCATTTCTGAAAATCATTGCTGTTTGG
ACCATATCAGTAGGTATATCCATGCCAATACCAGTCTTTGGGCTACAGGACGATTCGAAG
GTCTTTAAGGAGGGGAGTTGCTTACTCGCCGATGATAACTTTGTCCTGATCGGCTCTTTT
GTGTCATTTTTCATTCCCTTAACCATCATGGTGATCACCTACTTTCTAACTATCAAGTCA
CTCCAGAAAGAAGCTACTTTGTGTGTAAGTGATCTTGGCACACGGGCCAAATTAGCTTCT
TTCAGCTTCCTCCCTCAGAGTTCTTTGTCTTCAGAAAAGCTCTTCCAGCGGTCGATCCAT
AGGGAGCCAGGGTCCTACACAGGCAGGAGGACTATGCAGTCCATCAGCAATGAGCAAAAG
GCATGCAAGGTGCTGGGCATCGTCTTCTTCCTGTTTGTGGTGATGTGGTGCCCTTTCTTC
ATCACAAACATCATGGCCGTCATCTGCAAAGAGTCCTGCAATGAGGATGTCATTGGGGCC
CTGCTCAATGTGTTTGTTTGGATCGGTTATCTCTCTTCAGCAGTCAACCCACTAGTCTAC
ACACTGTTCAACAAGACCTATAGGTCAGCCTTTTCACGGTATATTCAGTGTCAGTACAAG
GAAAACAAAAAACCATTGCAGTTAATTTTAGTGAACACAATACCGGCTTTGGCCTACAAG
TCTAGCCAACTTCAAATGGGACAAAAAAAGAATTCAAAGCAAGATGCCAAGACAACAGAT
AATGACTGCTCAATGGTTGCTCTAGGAAAGCAGCATTCTGAAGAGGCTTCTAAAGACAAT
AGCGACGGAGTGAATGAAAAGGTGAGCTGTGTGTGA
Chromosome Location
13
Locus
13q14-q21
External Identifiers
ResourceLink
UniProtKB IDP28223
UniProtKB Entry Name5HT2A_HUMAN
GenBank Protein ID36431
GenBank Gene IDS42168
GenAtlas IDHTR2A
HGNC IDHGNC:5293
General References
  1. Saltzman AG, Morse B, Whitman MM, Ivanshchenko Y, Jaye M, Felder S: Cloning of the human serotonin 5-HT2 and 5-HT1C receptor subtypes. Biochem Biophys Res Commun. 1991 Dec 31;181(3):1469-78. [PubMed:1722404]
  2. Chen K, Yang W, Grimsby J, Shih JC: The human 5-HT2 receptor is encoded by a multiple intron-exon gene. Brain Res Mol Brain Res. 1992 Jun;14(1-2):20-6. [PubMed:1323014]
  3. Cook EH Jr, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL: Primary structure of the human platelet serotonin 5-HT2A receptor: identify with frontal cortex serotonin 5-HT2A receptor. J Neurochem. 1994 Aug;63(2):465-9. [PubMed:8035173]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Stam NJ, Van Huizen F, Van Alebeek C, Brands J, Dijkema R, Tonnaer JA, Olijve W: Genomic organization, coding sequence and functional expression of human 5-HT2 and 5-HT1A receptor genes. Eur J Pharmacol. 1992 Oct 1;227(2):153-62. [PubMed:1330647]
  8. Becamel C, Figge A, Poliak S, Dumuis A, Peles E, Bockaert J, Lubbert H, Ullmer C: Interaction of serotonin 5-hydroxytryptamine type 2C receptors with PDZ10 of the multi-PDZ domain protein MUPP1. J Biol Chem. 2001 Apr 20;276(16):12974-82. Epub 2001 Jan 9. [PubMed:11150294]
  9. Becamel C, Gavarini S, Chanrion B, Alonso G, Galeotti N, Dumuis A, Bockaert J, Marin P: The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins. J Biol Chem. 2004 May 7;279(19):20257-66. Epub 2004 Feb 26. [PubMed:14988405]
  10. Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. [PubMed:18476671]
  11. Cussac D, Boutet-Robinet E, Ailhaud MC, Newman-Tancredi A, Martel JC, Danty N, Rauly-Lestienne I: Agonist-directed trafficking of signalling at serotonin 5-HT2A, 5-HT2B and 5-HT2C-VSV receptors mediated Gq/11 activation and calcium mobilisation in CHO cells. Eur J Pharmacol. 2008 Oct 10;594(1-3):32-8. doi: 10.1016/j.ejphar.2008.07.040. Epub 2008 Jul 30. [PubMed:18703043]
  12. Gonzalez-Maeso J, Ang RL, Yuen T, Chan P, Weisstaub NV, Lopez-Gimenez JF, Zhou M, Okawa Y, Callado LF, Milligan G, Gingrich JA, Filizola M, Meana JJ, Sealfon SC: Identification of a serotonin/glutamate receptor complex implicated in psychosis. Nature. 2008 Mar 6;452(7183):93-7. doi: 10.1038/nature06612. Epub 2008 Feb 24. [PubMed:18297054]
  13. Knauer CS, Campbell JE, Chio CL, Fitzgerald LW: Pharmacological characterization of mitogen-activated protein kinase activation by recombinant human 5-HT2C, 5-HT2A, and 5-HT2B receptors. Naunyn Schmiedebergs Arch Pharmacol. 2009 May;379(5):461-71. doi: 10.1007/s00210-008-0378-4. Epub 2008 Dec 5. [PubMed:19057895]
  14. Albizu L, Holloway T, Gonzalez-Maeso J, Sealfon SC: Functional crosstalk and heteromerization of serotonin 5-HT2A and dopamine D2 receptors. Neuropharmacology. 2011 Sep;61(4):770-7. doi: 10.1016/j.neuropharm.2011.05.023. Epub 2011 May 27. [PubMed:21645528]
  15. Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. [PubMed:20945968]
  16. Delille HK, Becker JM, Burkhardt S, Bleher B, Terstappen GC, Schmidt M, Meyer AH, Unger L, Marek GJ, Mezler M: Heterocomplex formation of 5-HT2A-mGlu2 and its relevance for cellular signaling cascades. Neuropharmacology. 2012 Jun;62(7):2184-91. doi: 10.1016/j.neuropharm.2012.01.010. Epub 2012 Jan 25. [PubMed:22300836]
  17. Karaki S, Becamel C, Murat S, Mannoury la Cour C, Millan MJ, Prezeau L, Bockaert J, Marin P, Vandermoere F: Quantitative phosphoproteomics unravels biased phosphorylation of serotonin 2A receptor at Ser280 by hallucinogenic versus nonhallucinogenic agonists. Mol Cell Proteomics. 2014 May;13(5):1273-85. doi: 10.1074/mcp.M113.036558. Epub 2014 Mar 17. [PubMed:24637012]
  18. Assetta B, Maginnis MS, Gracia Ahufinger I, Haley SA, Gee GV, Nelson CD, O'Hara BA, Allen Ramdial SA, Atwood WJ: 5-HT2 receptors facilitate JC polyomavirus entry. J Virol. 2013 Dec;87(24):13490-8. doi: 10.1128/JVI.02252-13. Epub 2013 Oct 2. [PubMed:24089568]
  19. Erdmann J, Shimron-Abarbanell D, Rietschel M, Albus M, Maier W, Korner J, Bondy B, Chen K, Shih JC, Knapp M, Propping P, Nothen MM: Systematic screening for mutations in the human serotonin-2A (5-HT2A) receptor gene: identification of two naturally occurring receptor variants and association analysis in schizophrenia. Hum Genet. 1996 May;97(5):614-9. [PubMed:8655141]
  20. Marshall SE, Bird TG, Hart K, Welsh KI: Unified approach to the analysis of genetic variation in serotonergic pathways. Am J Med Genet. 1999 Dec 15;88(6):621-7. [PubMed:10581480]
  21. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00247MethysergideapprovedyesantagonistDetails
DB00370MirtazapineapprovedyesantagonistDetails
DB00434CyproheptadineapprovedyesantagonistDetails
DB00656Trazodoneapproved, investigationalyesantagonistDetails
DB00924CyclobenzaprineapprovedyesantagonistDetails
DB01149Nefazodoneapproved, withdrawnyesantagonistDetails
DB01224QuetiapineapprovedyesantagonistDetails
DB00246ZiprasidoneapprovedyesantagonistDetails
DB00334Olanzapineapproved, investigationalyesantagonistDetails
DB00363ClozapineapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB00734Risperidoneapproved, investigationalyesantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB00805MinaprineapprovedyesantagonistDetails
DB00933Mesoridazineapproved, investigationalyesantagonistDetails
DB01069Promethazineapproved, investigationalunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalyesantagonistDetails
DB01267PaliperidoneapprovedyesantagonistDetails
DB00696ErgotamineapprovedyesagonistDetails
DB00715Paroxetineapproved, investigationalunknownother/unknownDetails
DB00843Donepezilapprovedunknownother/unknownDetails
DB01242Clomipramineapproved, investigational, vet_approvedyesantagonistDetails
DB01442MMDAexperimental, illicityesagonistDetails
DB01239Chlorprothixeneexperimental, investigational, withdrawnyesantagonistDetails
DB00751Epinastineapproved, investigationalunknownantagonistDetails
DB05227APD791investigationalunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnyesantagonistDetails
DB04908Flibanserinapproved, investigationalyesantagonistDetails
DB12555NelotanserininvestigationalunknownDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB05079HY10275investigationalunknownDetails
DB05316Pimavanserinapproved, investigationalyesinverse agonistDetails
DB04946IloperidoneapprovedyesantagonistDetails
DB05687BL-1020investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB00604Cisaprideapproved, investigational, withdrawnyesagonistDetails
DB06077LumateperoneinvestigationalunknownDetails
DB06216AsenapineapprovedyesantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB12177EplivanserininvestigationalunknownDetails
DB06512DeramciclaneinvestigationalunknownantagonistDetails
DB04599AniracetamexperimentalunknownDetails
DB06446DotarizineinvestigationalunknownDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalyesagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00875Flupentixolapproved, investigational, withdrawnyesantagonistDetails
DB00502Haloperidolapprovedunknownother/unknownDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01618MolindoneapprovedunknownantagonistDetails
DB01488Dimethyltryptamineexperimental, illicitunknownDetails
DB01624Zuclopenthixolapproved, investigationalunknownantagonistDetails
DB00408LoxapineapprovedyesantagonistDetails
DB00321AmitriptylineapprovedyesantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalyesantagonistDetails
DB00458ImipramineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedyesantagonistDetails
DB00409Remoxiprideapproved, withdrawnunknownother/unknownDetails
DB00726TrimipramineapprovedunknownagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknownantagonistDetails
DB01079Tegaserodapproved, investigational, withdrawnunknownantagonistDetails
DB04842Fluspirileneapproved, investigationalunknownantagonistDetails
DB06288Amisulprideapproved, investigationalunknownantagonistDetails
DB01614Acepromazineexperimental, vet_approvedyesantagonistDetails
DB01621Pipotiazineapproved, investigationalyesantagonistDetails
DB01622ThioproperazineexperimentalyesantagonistDetails
DB01623ThiothixeneapprovedyesantagonistDetails
DB01454Midomafetamineexperimental, illicit, investigationalunknownagonistDetails
DB08810CinitaprideinvestigationalyesantagonistDetails
DB08815Lurasidoneapproved, investigationalyesantagonistDetails
DB08927AmperozideexperimentalunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownbinderDetails
DB09016ButriptylineapprovedyesantagonistDetails
DB09128Brexpiprazoleapproved, investigationalyesantagonistDetails
DB06016Cariprazineapproved, investigationalyesantagonistDetails
DB08922Perospironeexperimentalyesinverse agonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB00574Fenfluramineapproved, illicit, investigational, withdrawnunknownDetails
DB08839Serotonininvestigational, nutraceuticalunknownDetails
DB12465Ketanserininvestigationalunknowninverse agonistDetails
DB12693Ritanserininvestigationalunknowninverse agonistDetails
DB12163Sarpogrelateinvestigationalunknowninverse agonistDetails
DB00623FluphenazineapprovedunknownDetails
DB015374-Bromo-2,5-dimethoxyphenethylamineexperimental, illicitunknownpartial agonistDetails
DB09194EtoperidonewithdrawnyesantagonistDetails
DB09223BlonanserininvestigationalyesantagonistDetails
DB139402,5-Dimethoxy-4-ethylthioamphetamineexperimentalunknownagonistDetails
DB09061Cannabidiolapproved, investigationalunknownagonistDetails
DB13948N-(2-hydroxybenzyl)-2,5-dimethoxy-4-cyanophenylethylamineexperimentalunknownagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB09225Zotepineapproved, investigational, withdrawnyesantagonistDetails
DB09286PipamperoneinvestigationalunknownagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB140105-methoxy-N,N-dimethyltryptamineexperimental, illicitunknownagonistDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB14185Aripiprazole lauroxilapproved, investigationalyesantagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB09304SetiptilineexperimentalunknownantagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB12141Gilteritinibapproved, investigationalnoinhibitorDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownbinderDetails
DB01221Ketamineapproved, vet_approvedunknownantagonistDetails
DB06678Esmirtazapineinvestigationalunknowninverse agonistDetails