5-hydroxytryptamine receptor 2A
Details
- Name
- 5-hydroxytryptamine receptor 2A
- Synonyms
- 5-HT-2
- HTR2
- Serotonin receptor 2A
- Gene Name
- HTR2A
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0000899|5-hydroxytryptamine receptor 2A MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
- Number of residues
- 471
- Molecular Weight
- 52602.58
- Theoretical pI
- 7.72
- GO Classification
- Functions1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding / drug binding / serotonin binding / serotonin receptor activity / virus receptor activityProcessesactivation of phospholipase C activity / aging / artery smooth muscle contraction / behavioral response to cocaine / cell death / cellular calcium ion homeostasis / detection of mechanical stimulus involved in sensory perception of pain / detection of temperature stimulus involved in sensory perception of pain / memory / negative regulation of potassium ion transport / negative regulation of synaptic transmission, glutamatergic / phosphatidylinositol 3-kinase signaling / phospholipase C-activating serotonin receptor signaling pathway / positive regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of fat cell differentiation / positive regulation of glycolytic process / positive regulation of MAP kinase activity / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of phosphatidylinositol biosynthetic process / positive regulation of vasoconstriction / protein localization to cytoskeleton / regulation of behavior / regulation of dopamine secretion / regulation of hormone secretion / release of sequestered calcium ion into cytosol / response to drug / serotonin receptor signaling pathway / sleep / synaptic transmission / temperature homeostasis / urinary bladder smooth muscle contractionComponentsaxon / caveola / cell body fiber / cytoplasmic membrane-bounded vesicle / cytosol / dendritic shaft / integral component of plasma membrane / neuronal cell body / plasma membrane
- General Function
- Virus receptor activity
- Specific Function
- G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.(Microbial infection) Acts as a receptor for human JC polyomavirus/JCPyV.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 76-99 111-132 149-171 192-215 234-254 325-346 363-384
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0020465|5-hydroxytryptamine receptor 2A (HTR2A) ATGGATATTCTTTGTGAAGAAAATACTTCTTTGAGCTCAACTACGAACTCCCTAATGCAA TTAAATGATGACACCAGGCTCTACAGTAATGACTTTAACTCCGGAGAAGCTAACACTTCT GATGCATTTAACTGGACAGTCGACTCTGAAAATCGAACCAACCTTTCCTGTGAAGGGTGC CTCTCACCGTCGTGTCTCTCCTTACTTCATCTCCAGGAAAAAAACTGGTCTGCTTTACTG ACAGCCGTAGTGATTATTCTAACTATTGCTGGAAACATACTCGTCATCATGGCAGTGTCC CTAGAGAAAAAGCTGCAGAATGCCACCAACTATTTCCTGATGTCACTTGCCATAGCTGAT ATGCTGCTGGGTTTCCTTGTCATGCCCGTGTCCATGTTAACCATCCTGTATGGGTACCGG TGGCCTCTGCCGAGCAAGCTTTGTGCAGTCTGGATTTACCTGGACGTGCTCTTCTCCACG GCCTCCATCATGCACCTCTGCGCCATCTCGCTGGACCGCTACGTCGCCATCCAGAATCCC ATCCACCACAGCCGCTTCAACTCCAGAACTAAGGCATTTCTGAAAATCATTGCTGTTTGG ACCATATCAGTAGGTATATCCATGCCAATACCAGTCTTTGGGCTACAGGACGATTCGAAG GTCTTTAAGGAGGGGAGTTGCTTACTCGCCGATGATAACTTTGTCCTGATCGGCTCTTTT GTGTCATTTTTCATTCCCTTAACCATCATGGTGATCACCTACTTTCTAACTATCAAGTCA CTCCAGAAAGAAGCTACTTTGTGTGTAAGTGATCTTGGCACACGGGCCAAATTAGCTTCT TTCAGCTTCCTCCCTCAGAGTTCTTTGTCTTCAGAAAAGCTCTTCCAGCGGTCGATCCAT AGGGAGCCAGGGTCCTACACAGGCAGGAGGACTATGCAGTCCATCAGCAATGAGCAAAAG GCATGCAAGGTGCTGGGCATCGTCTTCTTCCTGTTTGTGGTGATGTGGTGCCCTTTCTTC ATCACAAACATCATGGCCGTCATCTGCAAAGAGTCCTGCAATGAGGATGTCATTGGGGCC CTGCTCAATGTGTTTGTTTGGATCGGTTATCTCTCTTCAGCAGTCAACCCACTAGTCTAC ACACTGTTCAACAAGACCTATAGGTCAGCCTTTTCACGGTATATTCAGTGTCAGTACAAG GAAAACAAAAAACCATTGCAGTTAATTTTAGTGAACACAATACCGGCTTTGGCCTACAAG TCTAGCCAACTTCAAATGGGACAAAAAAAGAATTCAAAGCAAGATGCCAAGACAACAGAT AATGACTGCTCAATGGTTGCTCTAGGAAAGCAGCATTCTGAAGAGGCTTCTAAAGACAAT AGCGACGGAGTGAATGAAAAGGTGAGCTGTGTGTGA
- Chromosome Location
- 13
- Locus
- 13q14-q21
- External Identifiers
Resource Link UniProtKB ID P28223 UniProtKB Entry Name 5HT2A_HUMAN GenBank Protein ID 36431 GenBank Gene ID S42168 GenAtlas ID HTR2A HGNC ID HGNC:5293 - General References
- Saltzman AG, Morse B, Whitman MM, Ivanshchenko Y, Jaye M, Felder S: Cloning of the human serotonin 5-HT2 and 5-HT1C receptor subtypes. Biochem Biophys Res Commun. 1991 Dec 31;181(3):1469-78. [PubMed:1722404]
- Chen K, Yang W, Grimsby J, Shih JC: The human 5-HT2 receptor is encoded by a multiple intron-exon gene. Brain Res Mol Brain Res. 1992 Jun;14(1-2):20-6. [PubMed:1323014]
- Cook EH Jr, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL: Primary structure of the human platelet serotonin 5-HT2A receptor: identify with frontal cortex serotonin 5-HT2A receptor. J Neurochem. 1994 Aug;63(2):465-9. [PubMed:8035173]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
- Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
- Stam NJ, Van Huizen F, Van Alebeek C, Brands J, Dijkema R, Tonnaer JA, Olijve W: Genomic organization, coding sequence and functional expression of human 5-HT2 and 5-HT1A receptor genes. Eur J Pharmacol. 1992 Oct 1;227(2):153-62. [PubMed:1330647]
- Becamel C, Figge A, Poliak S, Dumuis A, Peles E, Bockaert J, Lubbert H, Ullmer C: Interaction of serotonin 5-hydroxytryptamine type 2C receptors with PDZ10 of the multi-PDZ domain protein MUPP1. J Biol Chem. 2001 Apr 20;276(16):12974-82. Epub 2001 Jan 9. [PubMed:11150294]
- Becamel C, Gavarini S, Chanrion B, Alonso G, Galeotti N, Dumuis A, Bockaert J, Marin P: The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins. J Biol Chem. 2004 May 7;279(19):20257-66. Epub 2004 Feb 26. [PubMed:14988405]
- Nichols DE, Nichols CD: Serotonin receptors. Chem Rev. 2008 May;108(5):1614-41. doi: 10.1021/cr078224o. Epub 2008 May 14. [PubMed:18476671]
- Cussac D, Boutet-Robinet E, Ailhaud MC, Newman-Tancredi A, Martel JC, Danty N, Rauly-Lestienne I: Agonist-directed trafficking of signalling at serotonin 5-HT2A, 5-HT2B and 5-HT2C-VSV receptors mediated Gq/11 activation and calcium mobilisation in CHO cells. Eur J Pharmacol. 2008 Oct 10;594(1-3):32-8. doi: 10.1016/j.ejphar.2008.07.040. Epub 2008 Jul 30. [PubMed:18703043]
- Gonzalez-Maeso J, Ang RL, Yuen T, Chan P, Weisstaub NV, Lopez-Gimenez JF, Zhou M, Okawa Y, Callado LF, Milligan G, Gingrich JA, Filizola M, Meana JJ, Sealfon SC: Identification of a serotonin/glutamate receptor complex implicated in psychosis. Nature. 2008 Mar 6;452(7183):93-7. doi: 10.1038/nature06612. Epub 2008 Feb 24. [PubMed:18297054]
- Knauer CS, Campbell JE, Chio CL, Fitzgerald LW: Pharmacological characterization of mitogen-activated protein kinase activation by recombinant human 5-HT2C, 5-HT2A, and 5-HT2B receptors. Naunyn Schmiedebergs Arch Pharmacol. 2009 May;379(5):461-71. doi: 10.1007/s00210-008-0378-4. Epub 2008 Dec 5. [PubMed:19057895]
- Albizu L, Holloway T, Gonzalez-Maeso J, Sealfon SC: Functional crosstalk and heteromerization of serotonin 5-HT2A and dopamine D2 receptors. Neuropharmacology. 2011 Sep;61(4):770-7. doi: 10.1016/j.neuropharm.2011.05.023. Epub 2011 May 27. [PubMed:21645528]
- Pytliak M, Vargova V, Mechirova V, Felsoci M: Serotonin receptors - from molecular biology to clinical applications. Physiol Res. 2011;60(1):15-25. Epub 2010 Oct 15. [PubMed:20945968]
- Delille HK, Becker JM, Burkhardt S, Bleher B, Terstappen GC, Schmidt M, Meyer AH, Unger L, Marek GJ, Mezler M: Heterocomplex formation of 5-HT2A-mGlu2 and its relevance for cellular signaling cascades. Neuropharmacology. 2012 Jun;62(7):2184-91. doi: 10.1016/j.neuropharm.2012.01.010. Epub 2012 Jan 25. [PubMed:22300836]
- Karaki S, Becamel C, Murat S, Mannoury la Cour C, Millan MJ, Prezeau L, Bockaert J, Marin P, Vandermoere F: Quantitative phosphoproteomics unravels biased phosphorylation of serotonin 2A receptor at Ser280 by hallucinogenic versus nonhallucinogenic agonists. Mol Cell Proteomics. 2014 May;13(5):1273-85. doi: 10.1074/mcp.M113.036558. Epub 2014 Mar 17. [PubMed:24637012]
- Assetta B, Maginnis MS, Gracia Ahufinger I, Haley SA, Gee GV, Nelson CD, O'Hara BA, Allen Ramdial SA, Atwood WJ: 5-HT2 receptors facilitate JC polyomavirus entry. J Virol. 2013 Dec;87(24):13490-8. doi: 10.1128/JVI.02252-13. Epub 2013 Oct 2. [PubMed:24089568]
- Erdmann J, Shimron-Abarbanell D, Rietschel M, Albus M, Maier W, Korner J, Bondy B, Chen K, Shih JC, Knapp M, Propping P, Nothen MM: Systematic screening for mutations in the human serotonin-2A (5-HT2A) receptor gene: identification of two naturally occurring receptor variants and association analysis in schizophrenia. Hum Genet. 1996 May;97(5):614-9. [PubMed:8655141]
- Marshall SE, Bird TG, Hart K, Welsh KI: Unified approach to the analysis of genetic variation in serotonergic pathways. Am J Med Genet. 1999 Dec 15;88(6):621-7. [PubMed:10581480]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00247 Methysergide approved yes antagonist Details DB00370 Mirtazapine approved yes antagonist Details DB00434 Cyproheptadine approved yes antagonist Details DB00656 Trazodone approved, investigational yes antagonist Details DB00924 Cyclobenzaprine approved yes antagonist Details DB01149 Nefazodone approved, withdrawn yes antagonist Details DB01224 Quetiapine approved yes antagonist Details DB00246 Ziprasidone approved yes antagonist Details DB00334 Olanzapine approved, investigational yes antagonist Details DB00363 Clozapine approved yes antagonist Details DB00420 Promazine approved, vet_approved unknown antagonist Details DB00477 Chlorpromazine approved, investigational, vet_approved yes antagonist Details DB00679 Thioridazine approved, withdrawn yes antagonist Details DB00734 Risperidone approved, investigational yes antagonist Details DB00777 Propiomazine approved unknown antagonist Details DB00805 Minaprine approved yes antagonist Details DB00933 Mesoridazine approved, investigational yes antagonist Details DB01069 Promethazine approved, investigational unknown antagonist Details DB01238 Aripiprazole approved, investigational yes antagonist Details DB01267 Paliperidone approved yes antagonist Details DB00696 Ergotamine approved yes agonist Details DB00715 Paroxetine approved, investigational unknown other/unknown Details DB00843 Donepezil approved unknown other/unknown Details DB01242 Clomipramine approved, investigational, vet_approved yes antagonist Details DB01442 MMDA experimental, illicit yes agonist Details DB01239 Chlorprothixene experimental, investigational, withdrawn yes antagonist Details DB00751 Epinastine approved, investigational unknown antagonist Details DB05227 APD791 investigational unknown Details DB06144 Sertindole approved, investigational, withdrawn yes antagonist Details DB04908 Flibanserin approved, investigational yes antagonist Details DB12555 Nelotanserin investigational unknown Details DB06148 Mianserin approved, investigational unknown antagonist Details DB05079 HY10275 investigational unknown Details DB05316 Pimavanserin approved, investigational yes inverse agonist Details DB04946 Iloperidone approved yes antagonist Details DB05687 BL-1020 investigational unknown Details DB05492 Epicept NP-1 investigational unknown Details DB00604 Cisapride approved, investigational, withdrawn yes agonist Details DB06077 Lumateperone investigational unknown Details DB06216 Asenapine approved yes antagonist Details DB06229 Ocaperidone investigational unknown Details DB12177 Eplivanserin investigational unknown Details DB06512 Deramciclane investigational unknown antagonist Details DB04599 Aniracetam experimental unknown Details DB06446 Dotarizine investigational unknown Details DB01186 Pergolide approved, investigational, vet_approved, withdrawn unknown agonist Details DB01200 Bromocriptine approved, investigational unknown agonist Details DB00589 Lisuride approved, investigational yes agonist Details DB00248 Cabergoline approved unknown agonist Details DB00413 Pramipexole approved, investigational unknown unknown Details DB00714 Apomorphine approved, investigational unknown agonist Details DB00875 Flupentixol approved, investigational, withdrawn yes antagonist Details DB00502 Haloperidol approved unknown other/unknown Details DB01403 Methotrimeprazine approved, investigational unknown antagonist Details DB01618 Molindone approved unknown antagonist Details DB01488 Dimethyltryptamine experimental, illicit unknown Details DB01624 Zuclopenthixol approved, investigational unknown antagonist Details DB00408 Loxapine approved yes antagonist Details DB00321 Amitriptyline approved yes antagonist Details DB01142 Doxepin approved, investigational yes antagonist Details DB01151 Desipramine approved, investigational yes antagonist Details DB00458 Imipramine approved unknown antagonist Details DB00540 Nortriptyline approved yes antagonist Details DB00409 Remoxipride approved, withdrawn unknown other/unknown Details DB00726 Trimipramine approved unknown agonist Details DB01392 Yohimbine approved, investigational, vet_approved unknown antagonist Details DB01079 Tegaserod approved, investigational, withdrawn unknown antagonist Details DB04842 Fluspirilene approved, investigational unknown antagonist Details DB06288 Amisulpride approved, investigational unknown antagonist Details DB01614 Acepromazine experimental, vet_approved yes antagonist Details DB01621 Pipotiazine approved, investigational yes antagonist Details DB01622 Thioproperazine approved yes antagonist Details DB01623 Thiothixene approved yes antagonist Details DB01454 Midomafetamine experimental, illicit, investigational unknown agonist Details DB08810 Cinitapride investigational yes antagonist Details DB08815 Lurasidone approved, investigational yes antagonist Details DB08927 Amperozide experimental unknown antagonist Details DB00543 Amoxapine approved unknown antagonist Details DB00934 Maprotiline approved, investigational unknown binder Details DB09016 Butriptyline approved yes antagonist Details DB09128 Brexpiprazole approved, investigational yes antagonist Details DB06016 Cariprazine approved, investigational yes antagonist Details DB08922 Perospirone experimental yes inverse agonist Details DB09167 Dosulepin approved yes antagonist Details DB00574 Fenfluramine approved, illicit, investigational, withdrawn unknown Details DB08839 Serotonin investigational, nutraceutical unknown Details DB12465 Ketanserin investigational unknown inverse agonist Details DB12693 Ritanserin investigational unknown inverse agonist Details DB12163 Sarpogrelate investigational unknown inverse agonist Details DB00623 Fluphenazine approved unknown Details DB01537 4-Bromo-2,5-dimethoxyphenethylamine experimental, illicit unknown partial agonist Details DB09194 Etoperidone withdrawn yes antagonist Details DB09223 Blonanserin investigational yes antagonist Details DB13940 2,5-Dimethoxy-4-ethylthioamphetamine experimental unknown agonist Details DB09061 Cannabidiol approved, investigational unknown agonist Details DB13948 N-(2-hydroxybenzyl)-2,5-dimethoxy-4-cyanophenylethylamine experimental unknown agonist Details DB09195 Lorpiprazole approved yes antagonist Details DB00555 Lamotrigine approved, investigational unknown inhibitor Details DB09225 Zotepine approved, investigational, withdrawn yes antagonist Details DB09286 Pipamperone investigational unknown agonist Details DB06153 Pizotifen approved unknown antagonist Details DB14010 5-methoxy-N,N-dimethyltryptamine experimental, illicit unknown agonist Details DB14011 Nabiximols investigational unknown Details DB14009 Medical Cannabis experimental, investigational unknown Details DB14185 Aripiprazole lauroxil approved, investigational yes antagonist Details DB13025 Tiapride investigational yes antagonist Details DB09304 Setiptiline experimental unknown antagonist Details DB13345 Dihydroergocristine approved, experimental yes antagonist Details DB01049 Ergoloid mesylate approved yes antagonistagonist Details DB11273 Dihydroergocornine approved yes antagonistagonist Details DB12141 Gilteritinib approved, investigational no inhibitor Details DB00477 Chlorpromazine approved, investigational, vet_approved unknown binder Details DB01221 Ketamine approved, vet_approved unknown antagonist Details DB06678 Esmirtazapine investigational unknown inverse agonist Details