Catalase

Details

Name
Catalase
Synonyms
  • 1.11.1.6
Gene Name
katA
Organism
Micrococcus luteus
Amino acid sequence
>lcl|BSEQ0011274|Catalase
MEHQKTTPHATGSTRQNGAPAVSDRQSLTVGSEGPIVLHDTHLLETHQHFNRMNIPERRP
HAKGSGAFGEFEVTEDVSKYTKALVFQPGTKTETLLRFSTVAGELGSPDTWRDVRGFALR
FYTEEGNYDLVGNNTPIFFLRDPMKFTHFIRSQKRLPDSGLRDATMQWDFWTNNPESAHQ
VTYLMGPRGLPRTWREMNGYGSHTYLWVNAQGEKHWVKYHFISQQGVHNLSNDEATKIAG
ENADFHRQDLFESIAKGDHPKWDLYIQAIPYEEGKTYRFNPFDLTKTISQKDYPRIKVGT
LTLNRNPENHFAQIESAAFSPSNTVPGIGLSPDRMLLGRAFAYHDAQLYRVGAHVNQLPV
NRPKNAVHNYAFEGQMWYDHTGDRSTYVPNSNGDSWSDETGPVDDGWEADGTLTREAQAL
RADDDDFGQAGTLVREVFSDQERDDFVETVAGALKGVRQDVQARAFEYWKNVDATIGQRI
EDEVKRHEGDGIPGVEAGGEARM
Number of residues
503
Molecular Weight
56905.52
Theoretical pI
5.97
GO Classification
Functions
catalase activity / heme binding / metal ion binding
Processes
hydrogen peroxide catabolic process / response to oxidative stress
Components
cytoplasm
General Function
Metal ion binding
Specific Function
Decomposes hydrogen peroxide into water and oxygen; serves to protect cells from the toxic effects of hydrogen peroxide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0003540|1512 bp
ATGGAGCACCAGAAGACGACGCCGCACGCGACCGGCTCGACCCGCCAGAACGGCGCCCCG
GCCGTCAGCGACCGCCAGTCCCTGACCGTGGGCAGCGAGGGTCCCATCGTCCTGCACGAC
ACCCACCTGCTGGAGACCCACCAGCACTTCAACCGCATGAACATCCCGGAGCGCCGCCCG
CACGCCAAGGGCTCGGGCGCGTTCGGCGAGTTCGAGGTGACCGAGGACGTGTCGAAGTAC
ACCAAGGCCCTCGTGTTCCAGCCGGGCACGAAGACCGAGACCCTCCTGCGCTTCTCCACC
GTGGCCGGCGAGCTCGGCTCCCCGGACACCTGGCGCGACGTGCGCGGCTTCGCGCTGCGC
TTCTACACCGAGGAGGGCAACTACGACCTCGTCGGCAACAACACCCCGATCTTCTTCCTG
CGCGACCCCATGAAGTTCACCCACTTCATCCGCTCGCAGAAGCGCCTGCCGGACTCCGGC
CTGCGCGATGCCACCATGCAGTGGGACTTCTGGACCAACAACCCCGAGTCGGCGCACCAG
GTGACCTACCTGATGGGCCCGCGCGGCCTGCCCCGCACCTGGCGTGAGATGAACGGCTAC
GGCTCCCACACCTACCTGTGGGTCAACGCCCAGGGTGAGAAGCACTGGGTGAAGTACCAC
TTCATCTCCCAGCAGGGCGTGCACAACCTCTCGAACGACGAGGCCACCAAGATCGCCGGC
GAGAACGCCGACTTCCACCGCCAGGACCTGTTCGAGTCCATCGCCAAGGGCGACCACCCC
AAGTGGGACCTCTACATCCAGGCGATCCCCTACGAGGAGGGCAAGACCTACCGGTTCAAC
CCCTTCGACCTGACGAAGACGATCTCCCAGAAGGACTACCCGCGCATCAAGGTCGGCACG
CTGACCCTGAACCGCAACCCGGAGAACCACTTCGCGCAGATCGAGTCCGCCGCGTTCAGC
CCGAGCAACACCGTGCCGGGCATCGGCCTGTCCCCGGACCGCATGCTCCTGGGCCGCGCC
TTCGCGTACCACGACGCGCAGCTGTACCGCGTGGGCGCCCACGTGAACCAGCTGCCGGTG
AACCGTCCCAAGAACGCGGTGCACAACTACGCCTTCGAGGGCCAGATGTGGTACGACCAC
ACCGGCGACCGCTCCACCTACGTGCCGAACTCCAACGGCGACTCCTGGTCGGACGAGACC
GGCCCGGTGGACGACGGCTGGGAGGCCGACGGCACCCTGACCCGTGAGGCCCAGGCGCTG
CGCGCGGACGACGACGACTTCGGCCAGGCCGGCACCCTCGTCCGCGAGGTCTTCTCGGAC
CAGGAGCGTGACGACTTCGTGGAGACCGTGGCCGGCGCGCTGAAGGGTGTCCGCCAGGAC
GTCCAGGCCCGCGCCTTCGAGTACTGGAAGAACGTGGACGCCACGATCGGCCAGCGCATC
GAGGACGAGGTCAAGCGCCACGAGGGCGACGGCATCCCGGGCGTCGAGGCCGGCGGCGAG
GCCCGCATGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP29422
UniProtKB Entry NameCATA_MICLU
GenBank Protein ID19571548
GenBank Gene IDAJ438208
General References
  1. Murshudov GN, Melik-Adamyan WR, Grebenko AI, Barynin VV, Vagin AA, Vainshtein BK, Dauter Z, Wilson KS: Three-dimensional structure of catalase from Micrococcus lysodeikticus at 1.5 A resolution. FEBS Lett. 1992 Nov 9;312(2-3):127-31. [PubMed:1426241]
  2. Murshudov GN, Grebenko AI, Brannigan JA, Antson AA, Barynin VV, Dodson GG, Dauter Z, Wilson KS, Melik-Adamyan WR: The structures of Micrococcus lysodeikticus catalase, its ferryl intermediate (compound II) and NADPH complex. Acta Crystallogr D Biol Crystallogr. 2002 Dec;58(Pt 12):1972-82. Epub 2002 Nov 23. [PubMed:12454454]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02235L-methionine (R)-S-oxideexperimentalunknownDetails