Kallistatin

Details

Name
Kallistatin
Synonyms
  • Kallikrein inhibitor
  • KST
  • Peptidase inhibitor 4
  • PI-4
  • PI4
  • Serpin A4
Gene Name
SERPINA4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049846|Kallistatin
MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAF
RFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRG
FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQ
LINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTT
VRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMR
WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEAS
KSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK
VVDPTKP
Number of residues
427
Molecular Weight
48541.51
Theoretical pI
Not Available
GO Classification
Functions
serine-type endopeptidase inhibitor activity
Processes
platelet degranulation
Components
extracellular exosome / extracellular region / extracellular space / platelet dense granule lumen
General Function
Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
Specific Function
Serine-type endopeptidase inhibitor activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049847|Kallistatin (SERPINA4)
ATGCATCTTATCGACTACCTGCTCCTCCTGCTGGTTGGACTACTGGCCCTTTCTCATGGC
CAGCTGCACGTTGAGCATGATGGTGAGAGTTGCAGTAACAGCTCCCACCAGCAGATTCTG
GAGACAGGTGAGGGCTCCCCCAGCCTCAAGATAGCCCCTGCCAATGCTGACTTTGCCTTC
CGCTTCTACTACCTGATCGCTTCGGAGACCCCGGGGAAGAACATCTTTTTCTCCCCGCTG
AGCATCTCGGCGGCCTACGCCATGCTTTCCCTGGGGGCCTGCTCACACAGCCGCAGCCAG
ATCCTTGAGGGCCTGGGCTTCAACCTCACCGAGCTGTCTGAGTCCGATGTCCATAGGGGC
TTCCAGCACCTCCTGCACACTCTCAACCTCCCCGGCCATGGGCTGGAAACACGCGTGGGC
AGTGCTCTGTTCCTGAGCCACAACCTGAAGTTCCTTGCAAAATTCCTGAATGACACCATG
GCCGTCTATGAGGCTAAACTCTTCCACACCAACTTCTACGACACTGTGGGCACAATCCAG
CTTATCAACGACCACGTCAAGAAGGAAACTCGAGGGAAGATTGTGGATTTGGTCAGTGAG
CTCAAGAAGGACGTCTTGATGGTGCTGGTGAATTACATTTACTTCAAAGCCCTGTGGGAG
AAACCATTCATTTCCTCAAGGACCACTCCCAAAGACTTCTATGTTGATGAGAACACAACA
GTCCGGGTGCCCATGATGCTGCAGGACCAGGAGCATCACTGGTATCTTCATGACAGATAC
TTGCCCTGCTCGGTGCTACGGATGGATTACAAAGGAGACGCAACCGTGTTTTTCATTCTC
CCTAACCAAGGCAAAATGAGGGAGATTGAAGAGGTTCTGACTCCAGAGATGCTAATGAGG
TGGAACAACTTGTTGCGGAAGAGGAATTTTTACAAGAAGCTAGAGTTGCATCTTCCCAAG
TTCTCCATTTCTGGCTCCTATGTATTAGATCAGATTTTGCCCAGGCTGGGCTTCACGGAT
CTGTTCTCCAAGTGGGCTGACTTATCCGGCATCACCAAACAGCAAAAACTGGAGGCATCC
AAAAGTTTCCACAAGGCCACCTTGGACGTGGATGAGGCTGGCACCGAGGCTGCAGCAGCC
ACCAGCTTCGCGATCAAATTCTTCTCTGCCCAGACCAATCGCCACATCCTGCGATTCAAC
CGGCCCTTCCTTGTGGTGATCTTTTCCACCAGCACCCAGAGTGTCCTCTTTCTGGGCAAG
GTCGTCGACCCCACGAAACCATAG
Chromosome Location
14
Locus
14q32.13
External Identifiers
ResourceLink
UniProtKB IDP29622
UniProtKB Entry NameKAIN_HUMAN
HGNC IDHGNC:8948
General References
  1. Chai KX, Chen LM, Chao J, Chao L: Kallistatin: a novel human serine proteinase inhibitor. Molecular cloning, tissue distribution, and expression in Escherichia coli. J Biol Chem. 1993 Nov 15;268(32):24498-505. [PubMed:8227002]
  2. Chai KX, Ward DC, Chao J, Chao L: Molecular cloning, sequence analysis, and chromosomal localization of the human protease inhibitor 4 (kallistatin) gene (PI4). Genomics. 1994 Sep 15;23(2):370-8. [PubMed:7835886]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Zhou GX, Chao L, Chao J: Kallistatin: a novel human tissue kallikrein inhibitor. Purification, characterization, and reactive center sequence. J Biol Chem. 1992 Dec 25;267(36):25873-80. [PubMed:1334488]
  5. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  6. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  7. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [PubMed:19139490]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails