Cellular retinoic acid-binding protein 1

Details

Name
Cellular retinoic acid-binding protein 1
Synonyms
  • Cellular retinoic acid-binding protein I
  • CRABP-I
  • RBP5
Gene Name
CRABP1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010358|Cellular retinoic acid-binding protein 1
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
Number of residues
137
Molecular Weight
15565.45
Theoretical pI
5.03
GO Classification
Functions
retinal binding / retinoic acid binding / retinoid binding / retinol binding / transporter activity
Processes
multicellular organismal development / retinoic acid catabolic process / signal transduction
Components
cytosol
General Function
Transporter activity
Specific Function
Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010359|Cellular retinoic acid-binding protein 1 (CRABP1)
ATGCCCAACTTCGCCGGCACCTGGAAGATGCGCAGCAGCGAGAATTTCGACGAGCTGCTC
AAGGCACTGGGTGTGAACGCCATGCTGAGGAAAGTGGCCGTAGCGGCTGCGTCCAAGCCG
CACGTGGAGATCCGCCAGGACGGGGATCAGTTCTACATCAAGACATCCACCACGGTGCGC
ACCACTGAGATCAACTTCAAGGTCGGAGAAGGCTTTGAGGAGGAGACCGTGGACGGACGC
AAGTGCAGGAGTTTAGCCACTTGGGAGAATGAGAACAAGATCCACTGCACGCAAACTCTT
CTTGAAGGGGACGGCCCCAAAACCTACTGGACCCGTGAGCTGGCCAACGATGAACTTATC
CTGACGTTTGGCGCCGATGACGTGGTCTGCACCAGAATTTATGTCCGAGAGTGA
Chromosome Location
15
Locus
15q24
External Identifiers
ResourceLink
UniProtKB IDP29762
UniProtKB Entry NameRABP1_HUMAN
GenBank Protein ID241542
GenBank Gene IDS74445
GenAtlas IDCRABP1
HGNC IDHGNC:2338
General References
  1. Eller MS, Oleksiak MF, McQuaid TJ, McAfee SG, Gilchrest BA: The molecular cloning and expression of two CRABP cDNAs from human skin. Exp Cell Res. 1992 Feb;198(2):328-36. [PubMed:1309505]
  2. Astrom A, Tavakkol A, Pettersson U, Cromie M, Elder JT, Voorhees JJ: Molecular cloning of two human cellular retinoic acid-binding proteins (CRABP). Retinoic acid-induced expression of CRABP-II but not CRABP-I in adult human skin in vivo and in skin fibroblasts in vitro. J Biol Chem. 1991 Sep 15;266(26):17662-6. [PubMed:1654334]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Budhu AS, Noy N: Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest. Mol Cell Biol. 2002 Apr;22(8):2632-41. [PubMed:11909957]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00523Alitretinoinapproved, investigationalunknownagonistDetails
DB00926EtretinatewithdrawnunknownDetails
DB04942TamibaroteneinvestigationalunknownDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails