Somatostatin receptor type 1

Details

Name
Somatostatin receptor type 1
Synonyms
  • SRIF-2
  • SS-1-R
Gene Name
SSTR1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010315|Somatostatin receptor type 1
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Number of residues
391
Molecular Weight
42685.77
Theoretical pI
8.4
GO Classification
Functions
neuropeptide binding / somatostatin receptor activity
Processes
cell surface receptor signaling pathway / cell-cell signaling / cellular response to estradiol stimulus / cerebellum development / digestion / forebrain development / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / glutamate receptor signaling pathway / negative regulation of cell proliferation / neuropeptide signaling pathway / response to nutrient / response to starvation / somatostatin signaling pathway / spermatogenesis / synaptic transmission
Components
cytoplasm / integral component of plasma membrane / neuron projection / plasma membrane
General Function
Somatostatin receptor activity
Specific Function
Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin insensitive G proteins.
Pfam Domain Function
Transmembrane Regions
57-84 95-120 132-153 176-196 220-244 271-296 304-327
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010316|Somatostatin receptor type 1 (SSTR1)
ATGTTCCCCAATGGCACCGCCTCCTCTCCTTCCTCCTCTCCTAGCCCCAGCCCGGGCAGC
TGCGGCGAAGGCGGCGGCAGCAGGGGCCCCGGGGCCGGCGCTGCGGACGGCATGGAGGAG
CCAGGGCGAAATGCGTCCCAGAACGGGACCTTGAGCGAGGGCCAGGGCAGCGCCATCCTG
ATCTCTTTCATCTACTCCGTGGTGTGCCTGGTGGGGCTGTGTGGGAACTCTATGGTCATC
TACGTGATCCTGCGCTATGCCAAGATGAAGACGGCCACCAACATCTACATCCTAAATCTG
GCCATTGCTGATGAGCTGCTCATGCTCAGCGTGCCCTTCCTAGTCACCTCCACGTTGTTG
CGCCACTGGCCCTTCGGTGCGCTGCTCTGCCGCCTCGTGCTCAGCGTGGACGCGGTCAAC
ATGTTCACCAGCATCTACTGTCTGACTGTGCTCAGCGTGGACCGCTACGTGGCCGTGGTG
CATCCCATCAAGGCGGCCCGCTACCGCCGGCCCACCGTGGCCAAGGTAGTAAACCTGGGC
GTGTGGGTGCTATCGCTGCTCGTCATCCTGCCCATCGTGGTCTTCTCTCGCACCGCGGCC
AACAGCGACGGCACGGTGGCTTGCAACATGCTCATGCCAGAGCCCGCTCAACGCTGGCTG
GTGGGCTTCGTGTTGTACACATTTCTCATGGGCTTCCTGCTGCCCGTGGGGGCTATCTGC
CTGTGCTACGTGCTCATCATTGCTAAGATGCGCATGGTGGCCCTCAAGGCCGGCTGGCAG
CAGCGCAAGCGCTCGGAGCGCAAGATCACCTTAATGGTGATGATGGTGGTGATGGTGTTT
GTCATCTGCTGGATGCCTTTCTACGTGGTGCAGCTGGTCAACGTGTTTGCTGAGCAGGAC
GACGCCACGGTGAGTCAGCTGTCGGTCATCCTCGGCTATGCCAACAGCTGCGCCAACCCC
ATCCTCTATGGCTTTCTCTCAGACAACTTCAAGCGCTCTTTCCAACGCATCCTATGCCTC
AGCTGGATGGACAACGCCGCGGAGGAGCCGGTTGACTATTACGCCACCGCGCTCAAGAGC
CGTGCCTACAGTGTGGAAGACTTCCAACCTGAGAACCTGGAGTCCGGCGGCGTCTTCCGT
AATGGCACCTGCACGTCCCGGATCACGACGCTCTGA
Chromosome Location
14
Locus
14q13
External Identifiers
ResourceLink
UniProtKB IDP30872
UniProtKB Entry NameSSR1_HUMAN
GenBank Protein ID307434
GenBank Gene IDM81829
GenAtlas IDSSTR1
HGNC IDHGNC:11330
General References
  1. Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S: Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney. Proc Natl Acad Sci U S A. 1992 Jan 1;89(1):251-5. [PubMed:1346068]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Schwarzler A, Kreienkamp HJ, Richter D: Interaction of the somatostatin receptor subtype 1 with the human homolog of the Shk1 kinase-binding protein from yeast. J Biol Chem. 2000 Mar 31;275(13):9557-62. [PubMed:10734105]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00104Octreotideapproved, investigationalyesDetails
DB06663PasireotideapprovedunknownDetails
DB13985Lutetium Lu 177 dotatateapproved, investigationalyesagonistDetails
DB09099Somatostatinapproved, investigationalyesagonistDetails
DB15494Edotreotide gallium Ga-68approvedyesligandDetails