Calcitonin receptor

Details

Name
Calcitonin receptor
Synonyms
  • CT-R
Gene Name
CALCR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037016|Calcitonin receptor
MQFSGEKISGQRDLQKSKMRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYV
VGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDF
DPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFT
LVISLGIFVFFRKLTTIFPLNWKYRKALSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVV
PNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWYYLLG
WGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTK
MRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFF
VATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQE
PRNEPANNQGEESAEIIPLNIIEQESSA
Number of residues
508
Molecular Weight
59351.865
Theoretical pI
8.71
GO Classification
Functions
calcitonin binding / calcitonin receptor activity / protein transporter activity / receptor activity
Processes
adenylate cyclase-activating G-protein coupled receptor signaling pathway / cell surface receptor signaling pathway / G-protein coupled receptor signaling pathway / positive regulation of adenylate cyclase activity / positive regulation of cAMP biosynthetic process / positive regulation of cytosolic calcium ion concentration / protein localization to plasma membrane / protein transport / receptor internalization / response to glucocorticoid
Components
cytosol / integral component of plasma membrane / plasma membrane
General Function
Receptor activity
Specific Function
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Pfam Domain Function
Transmembrane Regions
172-191 215-234 255-277 295-314 331-354 378-395 408-429
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010301|Calcitonin receptor (CALCR)
ATGCAATTTTCTGGAGAGAAGATTAGTGGACAAAGAGATCTTCAAAAATCAAAAATGAGG
TTCACATTTACAAGCCGGTGCTTGGCACTGTTTCTTCTTCTAAATCACCCAACCCCAATT
CTTCCTGCCTTTTCAAATCAAACCTATCCAACAATAGAGCCCAAGCCATTTCTTTACGTC
GTAGGACGAAAGAAGATGATGGATGCACAGTACAAATGCTATGACCGAATGCAGCAGTTA
CCCGCATACCAAGGAGAAGGTCCATATTGCAATCGCACCTGGGATGGATGGCTGTGCTGG
GATGACACACCGGCTGGAGTATTGTCCTATCAGTTCTGCCCAGATTATTTTCCGGATTTT
GATCCATCAGAAAAGGTTACAAAATACTGTGATGAAAAAGGTGTTTGGTTTAAACATCCT
GAAAACAATCGAACCTGGTCCAACTATACTATGTGCAATGCTTTCACTCCTGAGAAACTG
AAGAATGCATATGTTCTGTACTATTTGGCTATTGTGGGTCATTCTTTGTCAATTTTCACC
CTAGTGATTTCCCTGGGGATTTTCGTGTTTTTCAGAAAATTGACAACTATTTTTCCTTTG
AATTGGAAATATAGGAAGGCATTGAGCCTTGGCTGCCAAAGGGTAACCCTGCACAAGAAC
ATGTTTCTTACTTACATTCTGAATTCTATGATTATCATCATCCACCTGGTTGAAGTAGTA
CCCAATGGAGAGCTCGTGCGAAGGGACCCGGTGAGCTGCAAGATTTTGCATTTTTTCCAC
CAGTACATGATGGCCTGCAACTATTTCTGGATGCTCTGTGAAGGGATCTATCTTCATACA
CTCATTGTCGTGGCTGTGTTTACTGAGAAGCAACGCTTGCGGTGGTATTATCTCTTGGGC
TGGGGGTTCCCGCTGGTGCCAACCACTATCCATGCTATTACCAGGGCCGTGTACTTCAAT
GACAACTGCTGGCTGAGTGTGGAAACCCATTTGCTTTACATAATCCATGGACCTGTCATG
GCGGCACTTGTGGTCAATTTCTTCTTTTTGCTCAACATTGTCCGGGTGCTTGTGACCAAA
ATGAGGGAAACCCATGAGGCGGAATCCCACATGTACCTGAAGGCTGTGAAGGCCACCATG
ATCCTTGTGCCCCTGCTGGGAATCCAGTTTGTCGTCTTTCCCTGGAGACCTTCCAACAAG
ATGCTTGGGAAGATATATGATTACGTGATGCACTCTCTGATTCATTTCCAGGGCTTCTTT
GTTGCGACCATCTACTGCTTCTGCAACAATGAGGTCCAAACCACCGTGAAGCGCCAATGG
GCCCAATTCAAAATTCAGTGGAACCAGCGTTGGGGGAGGCGCCCCTCCAACCGCTCTGCT
CGCGCTGCAGCCGCTGCTGCGGAGGCTGGCGACATCCCAATTTACATCTGCCATCAGGAG
CTGAGGAATGAACCAGCCAACAACCAAGGCGAGGAGAGTGCTGAGATCATCCCTTTGAAT
ATCATAGAGCAAGAGTCATCTGCTTGA
Chromosome Location
7
Locus
7q21.3
External Identifiers
ResourceLink
UniProtKB IDP30988
UniProtKB Entry NameCALCR_HUMAN
GenBank Protein ID179880
GenBank Gene IDL00587
GenAtlas IDCALCR
HGNC IDHGNC:1440
General References
  1. Gorn AH, Lin HY, Yamin M, Auron PE, Flannery MR, Tapp DR, Manning CA, Lodish HF, Krane SM, Goldring SR: Cloning, characterization, and expression of a human calcitonin receptor from an ovarian carcinoma cell line. J Clin Invest. 1992 Nov;90(5):1726-35. [PubMed:1331173]
  2. Kuestner RE, Elrod RD, Grant FJ, Hagen FS, Kuijper JL, Matthewes SL, O'Hara PJ, Sheppard PO, Stroop SD, Thompson DL, et al.: Cloning and characterization of an abundant subtype of the human calcitonin receptor. Mol Pharmacol. 1994 Aug;46(2):246-55. [PubMed:8078488]
  3. Albrandt K, Brady EM, Moore CX, Mull E, Sierzega ME, Beaumont K: Molecular cloning and functional expression of a third isoform of the human calcitonin receptor and partial characterization of the calcitonin receptor gene. Endocrinology. 1995 Dec;136(12):5377-84. [PubMed:7588285]
  4. Frendo JL, Pichaud F, Mourroux RD, Bouizar Z, Segond N, Moukhtar MS, Jullienne A: An isoform of the human calcitonin receptor is expressed in TT cells and in medullary carcinoma of the thyroid. FEBS Lett. 1994 Apr 4;342(2):214-6. [PubMed:8143880]
  5. Nishikawa T, Ishikawa H, Yamamoto S, Koshihara Y: A novel calcitonin receptor gene in human osteoclasts from normal bone marrow. FEBS Lett. 1999 Sep 24;458(3):409-14. [PubMed:10570950]
  6. Beaudreuil J, Balasubramanian S, Chenais J, Taboulet J, Frenkian M, Orcel P, Jullienne A, Horne WC, de Vernejoul MC, Cressent M: Molecular characterization of two novel isoforms of the human calcitonin receptor. Gene. 2004 Dec 8;343(1):143-51. [PubMed:15563840]
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  8. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  9. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  11. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161]
  12. Nussenzveig DR, Mathew S, Gershengorn MC: Alternative splicing of a 48-nucleotide exon generates two isoforms of the human calcitonin receptor. Endocrinology. 1995 May;136(5):2047-51. [PubMed:7720653]
  13. Nakamura M, Hashimoto T, Nakajima T, Ichii S, Furuyama J, Ishihara Y, Kakudo K: A new type of human calcitonin receptor isoform generated by alternative splicing. Biochem Biophys Res Commun. 1995 Apr 17;209(2):744-51. [PubMed:7733946]
  14. Hebden C, Smalt R, Chambers T, Pondel MD: Multiple promoters regulate human calcitonin receptor gene expression. Biochem Biophys Res Commun. 2000 Jun 16;272(3):738-43. [PubMed:10860825]
  15. Simonin F, Karcher P, Boeuf JJ, Matifas A, Kieffer BL: Identification of a novel family of G protein-coupled receptor associated sorting proteins. J Neurochem. 2004 May;89(3):766-75. [PubMed:15086532]
  16. Masi L, Becherini L, Colli E, Gennari L, Mansani R, Falchetti A, Becorpi AM, Cepollaro C, Gonnelli S, Tanini A, Brandi ML: Polymorphisms of the calcitonin receptor gene are associated with bone mineral density in postmenopausal Italian women. Biochem Biophys Res Commun. 1998 Jul 9;248(1):190-5. [PubMed:9675109]
  17. Qi T, Dong M, Watkins HA, Wootten D, Miller LJ, Hay DL: Receptor activity-modifying protein-dependent impairment of calcitonin receptor splice variant Delta(1-47)hCT((a)) function. Br J Pharmacol. 2013 Feb;168(3):644-57. doi: 10.1111/j.1476-5381.2012.02197.x. [PubMed:22946511]
  18. Masi L, Becherini L, Gennari L, Colli E, Mansani R, Falchetti A, Cepollaro C, Gonnelli S, Tanini A, Brandi ML: Allelic variants of human calcitonin receptor: distribution and association with bone mass in postmenopausal Italian women. Biochem Biophys Res Commun. 1998 Apr 17;245(2):622-6. [PubMed:9571205]
  19. Taboulet J, Frenkian M, Frendo JL, Feingold N, Jullienne A, de Vernejoul MC: Calcitonin receptor polymorphism is associated with a decreased fracture risk in post-menopausal women. Hum Mol Genet. 1998 Dec;7(13):2129-33. [PubMed:9817931]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00017Salmon Calcitoninapproved, investigationalunknownagonistDetails
DB01278Pramlintideapproved, investigationalyesagonistDetails