Tautomerase PptA

Details

Name
Tautomerase PptA
Synonyms
  • 5.3.2.-
  • ydcE
Gene Name
pptA
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011161|Tautomerase PptA
MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEI
APQMEALIKKPGYSMNA
Number of residues
77
Molecular Weight
8672.84
Theoretical pI
4.66
GO Classification
Functions
intramolecular oxidoreductase activity, interconverting keto- and enol-groups
Processes
cellular aromatic compound metabolic process
Components
cytoplasm
General Function
Intramolecular oxidoreductase activity, interconverting keto- and enol-groups
Specific Function
Can use enol isomers of phenylpyruvate, 2-hydroxy-2,4-pentadienoate and (p-hydroxyphenyl)pyruvate as substrates.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011162|Tautomerase PptA (pptA)
ATGCCGCACATCGACATTAAATGTTTTCCGCGTGAACTGGACGAACAACAAAAAGCAGCA
CTTGCTGCAGATATTACCGACGTTATTATTCGTCATCTGAACAGTAAAGACAGTTCGATA
AGCATTGCTCTACAGCAGATTCAACCAGAATCTTGGCAAGCTATCTGGGATGCCGAAATC
GCGCCCCAAATGGAGGCTTTGATAAAGAAACCTGGTTATAGCATGAATGCTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP31992
UniProtKB Entry NamePPTA_ECOLI
GenBank Protein ID4377521
GenBank Gene IDX60998
General References
  1. Zhao S, Sandt CH, Feulner G, Vlazny DA, Gray JA, Hill CW: Rhs elements of Escherichia coli K-12: complex composites of shared and unique components that have different evolutionary histories. J Bacteriol. 1993 May;175(10):2799-808. [PubMed:8387990]
  2. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [PubMed:9097039]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  5. Almrud JJ, Kern AD, Wang SC, Czerwinski RM, Johnson WH Jr, Murzin AG, Hackert ML, Whitman CP: The crystal structure of YdcE, a 4-oxalocrotonate tautomerase homologue from Escherichia coli, confirms the structural basis for oligomer diversity. Biochemistry. 2002 Oct 8;41(40):12010-24. [PubMed:12356301]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02384(E)-2-Fluoro-P-HydroxycinnamateexperimentalunknownDetails
DB03793Benzoic acidapproved, investigationalunknownDetails