Cholecystokinin receptor type A

Details

Name
Cholecystokinin receptor type A
Synonyms
  • CCK-A receptor
  • CCK1-R
  • CCKRA
  • Cholecystokinin-1 receptor
Gene Name
CCKAR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010278|Cholecystokinin receptor type A
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Number of residues
428
Molecular Weight
47840.645
Theoretical pI
9.48
GO Classification
Functions
cholecystokinin receptor activity / peptide binding
Processes
actin cytoskeleton reorganization / axonogenesis / cellular response to hormone stimulus / cholecystokinin signaling pathway / digestion / feeding behavior / forebrain development / gastric acid secretion / insulin secretion / neuron migration / organ regeneration / pancreas development / pancreatic juice secretion / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of cytosolic calcium ion concentration / positive regulation of somatostatin secretion / reduction of food intake in response to dietary excess / regulation of calcium ion transport / regulation of hormone secretion / regulation of potassium ion transport / response to glucocorticoid / response to heat / response to lipopolysaccharide / response to nutrient / response to peptide / response to radiation / response to starvation / temperature homeostasis
Components
cytosol / endoplasmic reticulum / endosome / integral component of plasma membrane / lysosome / plasma membrane / terminal bouton
General Function
Peptide binding
Specific Function
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Pfam Domain Function
Transmembrane Regions
42-67 78-104 116-137 158-178 211-234 314-334 350-373
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010279|Cholecystokinin receptor type A (CCKAR)
ATGGATGTGGTTGACAGCCTTCTTGTGAATGGAAGCAACATCACTCCTCCCTGTGAACTC
GGGCTCGAAAATGAGACGCTTTTCTGCTTGGATCAGCCCCGTCCTTCCAAAGAGTGGCAG
CCAGCGGTGCAGATTCTCTTGTACTCCTTGATATTCCTGCTCAGCGTGCTGGGAAACACG
CTGGTCATCACCGTGCTGATTCGGAACAAGCGGATGCGGACGGTCACCAACATCTTCCTC
CTCTCCCTGGCTGTCAGCGACCTCATGCTCTGTCTCTTCTGCATGCCGTTCAACCTCATC
CCCAATCTGCTCAAGGATTTCATCTTCGGGAGCGCCGTTTGCAAGACCACCACCTACTTC
ATGGGCACCTCTGTGAGTGTATCTACCTTTAATCTGGTAGCCATATCTCTAGAGAGATAT
GGTGCGATTTGCAAACCCTTACAGTCCCGGGTCTGGCAGACAAAATCCCATGCTTTGAAG
GTGATTGCTGCTACCTGGTGCCTTTCCTTTACCATCATGACTCCGTACCCCATTTATAGC
AACTTGGTGCCTTTTACCAAAAATAACAACCAGACCGCGAATATGTGCCGCTTTCTACTG
CCAAATGATGTTATGCAGCAGTCCTGGCACACATTCCTGTTACTCATCCTCTTTCTTATT
CCTGGAATTGTGATGATGGTGGCATATGGATTAATCTCTTTGGAACTCTACCAGGGAATA
AAATTTGAGGCTAGCCAGAAGAAGTCTGCTAAAGAAAGGAAACCTAGCACCACCAGCAGC
GGCAAATATGAGGACAGCGATGGGTGTTACCTGCAAAAGACCAGGCCCCCGAGGAAGCTG
GAGCTCCGGCAGCTGTCCACCGGCAGCAGCAGCAGGGCCAACCGCATCCGGAGTAACAGC
TCCGCAGCCAACCTGATGGCCAAGAAAAGGGTGATCCGCATGCTCATCGTCATCGTGGTC
CTCTTCTTCCTGTGCTGGATGCCCATCTTCAGCGCCAACGCCTGGCGGGCCTACGACACC
GCCTCCGCAGAGCGCCGCCTCTCAGGAACCCCCATTTCCTTCATCCTCCTCCTGTCCTAC
ACCTCCTCCTGCGTCAACCCCATCATCTACTGCTTCATGAACAAACGCTTCCGCCTCGGC
TTCATGGCCACCTTCCCCTGCTGCCCCAATCCTGGTCCCCCAGGGGCGAGGGGAGAGGTG
GGGGAGGAGGAGGAAGGCGGGACCACAGGAGCCTCTCTGTCCAGGTTCTCGTACAGCCAT
ATGAGTGCCTCGGTGCCACCCCAGTGA
Chromosome Location
4
Locus
4p15.1-p15.2
External Identifiers
ResourceLink
UniProtKB IDP32238
UniProtKB Entry NameCCKAR_HUMAN
GenBank Protein ID306491
GenBank Gene IDL13605
GenAtlas IDCCKAR
HGNC IDHGNC:1570
General References
  1. Ulrich CD, Ferber I, Holicky E, Hadac E, Buell G, Miller LJ: Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor. Biochem Biophys Res Commun. 1993 May 28;193(1):204-11. [PubMed:8503909]
  2. de Weerth A, Pisegna JR, Huppi K, Wank SA: Molecular cloning, functional expression and chromosomal localization of the human cholecystokinin type A receptor. Biochem Biophys Res Commun. 1993 Jul 30;194(2):811-8. [PubMed:8343165]
  3. Miller LJ, Holicky EL, Ulrich CD, Wieben ED: Abnormal processing of the human cholecystokinin receptor gene in association with gallstones and obesity. Gastroenterology. 1995 Oct;109(4):1375-80. [PubMed:7557108]
  4. Funakoshi A, Miyasaka K, Matsumoto H, Yamamori S, Takiguchi S, Kataoka K, Takata Y, Matsusue K, Kono A, Shimokata H: Gene structure of human cholecystokinin (CCK) type-A receptor: body fat content is related to CCK type-A receptor gene promoter polymorphism. FEBS Lett. 2000 Jan 28;466(2-3):264-6. [PubMed:10682840]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Pellegrini M, Mierke DF: Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin A receptor by NMR spectroscopy. Biochemistry. 1999 Nov 9;38(45):14775-83. [PubMed:10555959]
  8. Giragossian C, Mierke DF: Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin A receptor. Biochemistry. 2001 Apr 3;40(13):3804-9. [PubMed:11300760]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00403CeruletideapprovedyesinducerDetails
DB04856DexloxiglumideinvestigationalunknownDetails
DB04867LintitriptinvestigationalunknownDetails
DB08862Cholecystokininapproved, investigationalunknownagonistDetails