3-carboxy-cis,cis-muconate cycloisomerase

Details

Name
3-carboxy-cis,cis-muconate cycloisomerase
Synonyms
  • 3-carboxymuconate lactonizing enzyme
  • 5.5.1.2
  • CMLE
Gene Name
pcaB
Organism
Pseudomonas putida
Amino acid sequence
>lcl|BSEQ0006379|3-carboxy-cis,cis-muconate cycloisomerase
MTNQLFDAYFTAPAMREIFSDRGRLQGMLDFEAALARAEAAAGLVPHSAVAAIEAACKAE
RYDVGALANAIATAGNSAIPLVKALGKVIASGVPEAERYVHLGATSQDAMDTGLVLQLRD
ALDLIEADLGKLADTLSQQALKHADTPMVGRTWLQHATPVTLGMKLAGVLGALTRHRQRL
QELGPPCWCCSSGGASGSLAALGSKAMPVAEALAEQLKLSLPEQPWHTQRDRLVEFASVL
GLVAGSLGKFGRDVSLLMQTEAGEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPG
LVSTLFAAMPQEHERSLGLWHAEWETLPDICCLVSGALRQAQVIAEGIEVDAARMRRNLD
LTQGLVLAEAVSIVLARTLGRDRAHHLLEQCCQRAVAEQRHLRAVLGDDPQVSAELSAEE
LD
Number of residues
422
Molecular Weight
44675.755
Theoretical pI
5.93
GO Classification
Functions
3-carboxy-cis,cis-muconate cycloisomerase activity
Processes
3,4-dihydroxybenzoate catabolic process / beta-ketoadipate pathway
Components
cytoplasm
General Function
3-carboxy-cis,cis-muconate cycloisomerase activity
Specific Function
Catalyzes an anti cycloisomerization.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0006378|1224 bp
ATGACCAACCAACTGTTCGACGCCTACTTCACCGCGCCGGCCATGCGCGAGATTTTCTCC
GACCGTGGCCGCTTGCAGGGCATGCTCGATTTCGAAGCCGCGCTGGCCCGTGCCGAAGCT
GCTGCGGGGCTGGTCCCGCACAGCGCCGTGGCCGCCATCGAGGCGGCATGCAAGGCCGAG
CGCTATGACGTGGGGGCGCTGGCCAATGCCATCGCAACCGCTGGCAACTCGGCAATCCCG
CTGGTGAAGGCGTTGGGCAAGGTGATTGCCAGTGGCGTGCCCGAGGCCGAGCGCTATGTG
CACTTGGGCGCCACCAGCCAGGACGCGATGGACACCGGTCTGGTGTTGCAGTTGCGCGAT
GCCCTCGACCTGATCGAAGCGGACCTGGGCAAACTGGCCGATACCCTGTCGCAGCAGGCA
TTGAAGCACGCCGATACGCCAATGGTGGGCCGCACCTGGCTGCAACACGCTACCCCGGTG
ACCCTGGGCATGAAACTGGCTGGCGTGCTGGGGGCATTGACCCGCCACCGTCAGCGCCTG
CAAGAGCTCGGCCCGCCCTGTTGGTGCTGCAGTTCCGGCGGCGCCTCGGGCAGCCTGGCC
GCTCTGGGCAGCAAGGCGATGCCGGTGGCCGAGGCCCTGGCCGAGCAACTGAAGCTGAGC
CTGCCCGAGCAACCCTGGCACACCCAGCGTGATCGCCTGGTGGAGTTTGCCTCGGTGCTG
GGCCTTGTGGCCGGCAGCCTGGGCAAGTTCGGCCGCGATGTCAGCCTGCTGATGCAAACC
GAGGCGGGGGAGGTGTTCGAGCCTTCTGCACCAGGCAAGGGCGGCTCCTCGACCATGCCA
CACAAGCGCAACCCGGTGGGCGCTGCGGTGCTGATCGGTGCCGCGACTCGCGTGCCGGGG
CTGGTATCGACGCTGTTCGCCGCCATGCCCCAGGAGCACGAGCGCAGCCTGGGCCTGTGG
CATGCCGAATGGGAAACCCTCCCGGACATCTGCTGCCTGGTCTCCGGCGCGCTGCGCCAG
GCCCAGGTCATTGCCGAGGGCATTGAAGTAGACGCAGCGCGCATGCGCCGTAACCTCGAC
CTGACCCAAGGGCTGGTGCTGGCAGAAGCGGTGAGTATCGTCCTGGCCCGAACGCCTGGG
CCGCGACCGTGCCCACCACTTGCTGGAGCAATGCTGCCAGCGAGCCGTGGCCGAACAGCG
GCACCTGCGTGCGGTGCTGGGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP32427
UniProtKB Entry NamePCAB_PSEPU
GenBank Gene IDL17082
General References
  1. Williams SE, Woolridge EM, Ransom SC, Landro JA, Babbitt PC, Kozarich JW: 3-Carboxy-cis,cis-muconate lactonizing enzyme from Pseudomonas putida is homologous to the class II fumarase family: a new reaction in the evolution of a mechanistic motif. Biochemistry. 1992 Oct 13;31(40):9768-76. [PubMed:1390752]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04272Citric acidapproved, nutraceutical, vet_approvedunknownDetails
DB044471,4-DithiothreitolexperimentalunknownDetails