Heat-labile enterotoxin B chain

Details

Name
Heat-labile enterotoxin B chain
Synonyms
  • LT-B, porcine
  • LTP-B
  • ltpB
Gene Name
eltB
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0011042|Heat-labile enterotoxin B chain
MNKVKCYVLFTALLSSLYAHGAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVI
ITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAI
SMKN
Number of residues
124
Molecular Weight
14133.255
Theoretical pI
9.12
GO Classification
Processes
killing of cells of other organism / pathogenesis
Components
extracellular region
General Function
Not Available
Specific Function
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002931|375 bp
ATGAATAAAGTAAAATGTTATGTTTTATTTACGGCGTTACTATCCTCTCTATATGCACAC
GGAGCTCCCCAGACTATTACAGAACTATGTTCGGAATATCGCAACACACAAATATATACG
ATAAATGACAAGATACTATCATATACGGAATCGATGGCAGGCAAAAGAGAAATGGTTATC
ATTACATTTAAGAGCGGCGAAACATTTCAGGTCGAAGTCCCGGGCAGTCAACATATAGAC
TCCCAGAAAAAAGCCATTGAAAGGATGAAGGACACATTAAGAATCACATATCTGACCGAG
ACCAAAATTGATAAATTATGTGTATGGAATAATAAAACCCCCAATTCAATTGCGGCAATC
AGTATGAAAAACTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP32890
UniProtKB Entry NameELBP_ECOLX
GenBank Protein ID145833
GenBank Gene IDM17873
General References
  1. Dallas WS, Falkow S: Amino acid sequence homology between cholera toxin and Escherichia coli heat-labile toxin. Nature. 1980 Dec 4;288(5790):499-501. [PubMed:7003397]
  2. Leong J, Vinal AC, Dallas WS: Nucleotide sequence comparison between heat-labile toxin B-subunit cistrons from Escherichia coli of human and porcine origin. Infect Immun. 1985 Apr;48(1):73-7. [PubMed:3884513]
  3. Yamamoto T, Gojobori T, Yokota T: Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1. J Bacteriol. 1987 Mar;169(3):1352-7. [PubMed:3546273]
  4. Ibrahimi I, Gentz R: A functional interaction between the signal peptide and the translation apparatus is detected by the use of a single point mutation which blocks translocation across mammalian endoplasmic reticulum. J Biol Chem. 1987 Jul 25;262(21):10189-94. [PubMed:3301830]
  5. Tsuji T, Iida T, Honda T, Miwatani T, Nagahama M, Sakurai J, Wada K, Matsubara H: A unique amino acid sequence of the B subunit of a heat-labile enterotoxin isolated from a human enterotoxigenic Escherichia coli. Microb Pathog. 1987 May;2(5):381-90. [PubMed:3333803]
  6. Sixma TK, Kalk KH, van Zanten BA, Dauter Z, Kingma J, Witholt B, Hol WG: Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin. J Mol Biol. 1993 Apr 5;230(3):890-918. [PubMed:8478941]
  7. Sixma TK, Pronk SE, Kalk KH, Wartna ES, van Zanten BA, Witholt B, Hol WG: Crystal structure of a cholera toxin-related heat-labile enterotoxin from E. coli. Nature. 1991 May 30;351(6325):371-7. [PubMed:2034287]
  8. Pickens JC, Merritt EA, Ahn M, Verlinde CL, Hol WG, Fan E: Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes. Chem Biol. 2002 Feb;9(2):215-24. [PubMed:11880036]
  9. Domenighini M, Pizza M, Jobling MG, Holmes RK, Rappuoli R: Identification of errors among database sequence entries and comparison of correct amino acid sequences for the heat-labile enterotoxins of Escherichia coli and Vibrio cholerae. Mol Microbiol. 1995 Mar;15(6):1165-7. [PubMed:7623669]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02213Metanitrophenyl-Alpha-D-GalactosideexperimentalunknownDetails
DB03242P-Aminophenyl-Alpha-D-GalactopyranosideexperimentalunknownDetails
DB034212-Phenethyl-2,3-Dihydro-Phthalazine-1,4-DioneexperimentalunknownDetails
DB03446N-Benzyl-3-(alpha-D-galactopyranosyloxy)benzamideexperimentalunknownDetails
DB03793Benzoic Acidapproved, investigationalunknownDetails
DB04040N-(2-Morpholin-4-Yl-1-Morpholin-4-Ylmethyl-Ethyl)-3-Nitro-5-(3,4,5-Trihydroxy-6-Hydroxymethyl-Tetrahydro-Pyran-2-Yloxy)-BenzamideexperimentalunknownDetails
DB04396ThiodigalactosideexperimentalunknownDetails