5-hydroxytryptamine receptor 7

Details

Name
5-hydroxytryptamine receptor 7
Synonyms
  • 5-HT-7
  • 5-HT-X
  • Serotonin receptor 7
Gene Name
HTR7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001296|5-hydroxytryptamine receptor 7
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Number of residues
479
Molecular Weight
53554.43
Theoretical pI
8.97
GO Classification
Functions
serotonin receptor activity
Processes
blood circulation / circadian rhythm / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / serotonin receptor signaling pathway / smooth muscle contraction / synaptic transmission / vasoconstriction
Components
integral component of plasma membrane / plasma membrane
General Function
Serotonin receptor activity
Specific Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Pfam Domain Function
Transmembrane Regions
84-104 118-138 158-178 202-222 237-257 326-346 368-388
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010453|5-hydroxytryptamine receptor 7 (HTR7)
ATGATGGACGTTAACAGCAGCGGCCGCCCGGACCTCTACGGGCACCTCCGCTCTTTCCTT
CTGCCAGAAGTGGGGCGCGGGCTGCCCGACTTGAGCCCCGACGGTGGCGCCGACCCGGTC
GCGGGCTCCTGGGCGCCGCACCTGCTGAGCGAGGTGACAGCCAGCCCGGCGCCCACCTGG
GACGCGCCCCCGGACAATGCCTCCGGCTGTGGGGAACAGATCAACTACGGCAGAGTCGAG
AAAGTTGTGATCGGCTCCATCCTGACGCTCATCACGCTGCTGACGATCGCGGGCAACTGC
CTGGTGGTGATCTCCGTGTGCTTCGTCAAGAAGCTCCGCCAGCCCTCCAACTACCTGATC
GTGTCCCTGGCGCTGGCCGACCTCTCGGTGGCTGTGGCGGTCATGCCCTTCGTCAGCGTC
ACCGACCTCATCGGGGGCAAGTGGATCTTTGGACACTTTTTCTGTAATGTCTTCATCGCC
ATGGACGTCATGTGCTGCACGGCCTCGATCATGACCCTGTGCGTGATCAGCATTGACAGG
TACCTTGGGATCACAAGGCCCCTCACATACCCTGTGAGGCAGAATGGGAAATGCATGGCG
AAGATGATTCTCTCCGTCTGGCTTCTCTCCGCCTCCATCACCTTACCTCCACTCTTTGGA
TGGGCTCAGAATGTAAATGATGATAAGGTGTGCTTGATCAGCCAGGACTTTGGCTATACG
ATTTACTCTACCGCAGTGGCATTTTATATCCCCATGTCCGTCATGCTTTTCATGTACTAC
CAGATTTACAAGGCTGCCAGGAAGAGTGCTGCCAAACACAAGTTTCCTGGCTTCCCTCGA
GTGGAGCCAGACAGCGTCATCGCCCTGAATGGCATAGTGAAGCTCCAGAAGGAGGTGGAA
GAGTGTGCAAACCTTTCGAGACTCCTCAAGCATGAAAGGAAAAACATCTCCATCTTTAAG
CGAGAACAGAAAGCAGCCACCACCCTGGGGATCATCGTCGGGGCCTTTACCGTGTGCTGG
CTGCCATTTTTCCTCCTCTCGACAGCCAGACCCTTCATCTGTGGCACTTCCTGCAGCTGC
ATCCCACTGTGGGTGGAGAGGACATTTCTGTGGCTAGGCTATGCAAACTCTCTCATTAAC
CCTTTTATATATGCCTTCTTCAACCGGGACCTGAGGACCACCTATCGCAGCCTGCTCCAG
TGCCAGTACCGGAATATCAACCGGAAGCTCTCAGCTGCAGGCATGCATGAAGCCCTGAAG
CTTGCTGAGAGGCCAGAGAGACCTGAGTTTGTGCTACAAAATGCTGACTACTGTAGAAAA
AAAGGTCATGATTCATGA
Chromosome Location
10
Locus
10q21-q24
External Identifiers
ResourceLink
UniProtKB IDP34969
UniProtKB Entry Name5HT7R_HUMAN
GenBank Protein ID1857143
GenBank Gene IDU68487
GenAtlas IDHTR7
HGNC IDHGNC:5302
General References
  1. Heidmann DE, Metcalf MA, Kohen R, Hamblin MW: Four 5-hydroxytryptamine7 (5-HT7) receptor isoforms in human and rat produced by alternative splicing: species differences due to altered intron-exon organization. J Neurochem. 1997 Apr;68(4):1372-81. [PubMed:9084407]
  2. Bard JA, Zgombick J, Adham N, Vaysse P, Branchek TA, Weinshank RL: Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase. J Biol Chem. 1993 Nov 5;268(31):23422-6. [PubMed:8226867]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Gellynck E, Andressen KW, Lintermans B, Haegeman G, Levy FO, Vanhoenacker P, Van Craenenbroeck K: Biochemical and pharmacological study of N-linked glycosylation of the human serotonin 5-HT(7)a receptor. FEBS J. 2012 Jun;279(11):1994-2003. doi: 10.1111/j.1742-4658.2012.08581.x. Epub 2012 Apr 25. [PubMed:22448645]
  8. Erdmann J, Nothen MM, Shimron-Abarbanell D, Rietschel M, Albus M, Borrmann M, Maier W, Franzek E, Korner J, Weigelt B, Fimmers R, Propping P: The human serotonin 7 (5-HT7) receptor gene: genomic organization and systematic mutation screening in schizophrenia and bipolar affective disorder. Mol Psychiatry. 1996 Nov;1(5):392-7. [PubMed:9154233]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00246ZiprasidoneapprovedunknownantagonistDetails
DB00247MethysergideapprovedyesantagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB01200Bromocriptineapproved, investigationalunknownantagonistDetails
DB00751Epinastineapproved, investigationalunknownantagonistDetails
DB00363ClozapineapprovedunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalunknownantagonistpartial agonistDetails
DB01224QuetiapineapprovedunknownligandDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB06288Amisulprideapproved, investigationalyesantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB08815Lurasidoneapproved, investigationalunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownbinderDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00988DopamineapprovedunknownbinderDetails
DB00321AmitriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB09068Vortioxetineapproved, investigationalyesantagonistDetails
DB00589Lisurideapproved, investigationalunknownDetails
DB01267PaliperidoneapprovedunknownDetails
DB00434CyproheptadineapprovedunknownDetails
DB13988SB-269970investigationalunknownantagonistDetails
DB09225Zotepineapproved, investigational, withdrawnyesantagonistDetails
DB04948Lofexidineapproved, investigationalnoagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownDetails
DB00502HaloperidolapprovedunknownDetails
DB00924CyclobenzaprineapprovedunknownantagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB00315Zolmitriptanapproved, investigationalnoagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB09304SetiptilineexperimentalunknownantagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB12141Gilteritinibapproved, investigationalnoinhibitorDetails
DB00715Paroxetineapproved, investigationalunknownDetails
DB01239Chlorprothixeneapproved, experimental, investigational, withdrawnyesinhibitorDetails