Prostaglandin E2 receptor EP1 subtype

Details

Name
Prostaglandin E2 receptor EP1 subtype
Synonyms
  • PGE receptor EP1 subtype
  • Prostanoid EP1 receptor
Gene Name
PTGER1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000128|Prostaglandin E2 receptor EP1 subtype
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
Number of residues
402
Molecular Weight
41800.655
Theoretical pI
12.22
GO Classification
Functions
prostaglandin E receptor activity
Processes
G-protein coupled receptor signaling pathway / response to lipopolysaccharide
Components
integral component of plasma membrane / plasma membrane
General Function
Prostaglandin e receptor activity
Specific Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues.
Pfam Domain Function
Transmembrane Regions
36-62 73-96 112-133 156-177 202-227 295-321 333-354
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0018915|Prostaglandin E2 receptor EP1 subtype (PTGER1)
ATGAGCCCTTGCGGGCCCCTCAACCTGAGCCTGGCGGGCGAGGCGACCACATGCGCGGCG
CCCTGGGTCCCCAACACGTCGGCCGTGCCGCCGTCGGGCGCTTCGCCCGCGCTGCCCATC
TTCTCCATGACGCTGGGCGCCGTGTCCAACCTGCTGGCGCTGGCGCTGCTGGCGCAGGCC
GCGGGCCGCCTGCGACGCCGCCGCTCGGCCGCCACCTTCCTGCTGTTCGTGGCCAGCCTG
CTGGCCACCGACCTGGCGGGCCACGTGATCCCGGGCGCGCTGGTGCTGCGTCTGTACACT
GCGGGGCGCGCTCCGGCCGGCGGGGCCTGCCACTTCCTGGGCGGCTGCATGGTCTTCTTC
GGCCTGTGCCCGCTGCTGCTGGGCTGTGGCATGGCCGTGGAGCGCTGCGTGGGCGTCACG
CGGCCGCTGCTCCACGCCGCGCGGGTCTCGGTCGCCCGCGCGCGCCTGGCGCTGGCCGCG
GTGGCCGCGGTGGCCTTGGCCGTGGCGCTGCTGCCGCTGGCGCGCGTGGGCCGCTATGAG
CTGCAGTACCCGGGCACGTGGTGCTTCATCGGCCTGGGTCCCCCGGGCGGCTGGCGCCAG
GCACTGCTTGCTGGCCTCTTCGCCAGCCTCGGCCTGGTCGCGCTCCTCGCCGCGCTGGTG
TGCAACACGCTCAGCGGCCTGGCCCTGCTACGCGCCCGCTGGCGACGCCGCTCCCGACGG
CCTCCCCCGGCCTCAGGCCCCGACAGCCGGCGTCGCTGGGGGGCGCACGGACCCCGCTCG
GCCTCCGCCTCGTCCGCCTCGTCCATCGCTTCGGCCTCCACCTTCTTTGGCGGCTCTCGG
AGCAGCGGCTCGGCACGCAGAGCTCGCGCCCACGACGTGGAGATGGTGGGCCAGCTTGTC
GGTATCATGGTGGTGTCGTGCATCTGCTGGAGCCCAATGCTGGTGTTGGTGGCGCTGGCC
GTCGGCGGCTGGAGCTCTACCTCCCTGCAGCGGCCACTGTTCCTGGCCGTGCGCCTTGCC
TCCTGGAACCAGATCCTGGACCCTTGGGTGTACATCCTACTGCGCCAGGCCGTGCTGCGC
CAACTGCTTCGCCTCTTGCCCCCGAGGGCCGGAGCCAAGGGCGGCCCCGCGGGGCTGGGC
CTAACACCGAGCGCCTGGGAGGCCAGCTCGCTGCGCAGCTCCCGGCACAGCGGCCTCAGC
CACTTCTAA
Chromosome Location
19
Locus
19p13.1
External Identifiers
ResourceLink
UniProtKB IDP34995
UniProtKB Entry NamePE2R1_HUMAN
GenBank Protein ID410209
GenBank Gene IDL22647
GenAtlas IDPTGER1
HGNC IDHGNC:9593
General References
  1. Funk CD, Furci L, FitzGerald GA, Grygorczyk R, Rochette C, Bayne MA, Abramovitz M, Adam M, Metters KM: Cloning and expression of a cDNA for the human prostaglandin E receptor EP1 subtype. J Biol Chem. 1993 Dec 15;268(35):26767-72. [PubMed:8253813]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00429Carboprost tromethamineapprovedyesagonistDetails
DB00297Bupivacaineapproved, investigationalunknownother/unknownDetails
DB00770Alprostadilapproved, investigationalyesagonistDetails
DB00905Bimatoprostapproved, investigationalyesagonistDetails
DB00917DinoprostoneapprovedyesagonistDetails
DB01088Iloprostapproved, investigationalyesagonistDetails
DB09211LimaprostinvestigationalunknownagonistDetails
DB00929MisoprostolapprovedyesagonistDetails