Somatostatin receptor type 5

Details

Name
Somatostatin receptor type 5
Synonyms
  • SS-5-R
Gene Name
SSTR5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016698|Somatostatin receptor type 5
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Number of residues
364
Molecular Weight
39201.925
Theoretical pI
9.72
GO Classification
Functions
neuropeptide binding / somatostatin receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / cellular response to estradiol stimulus / cellular response to glucocorticoid stimulus / G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / glucose homeostasis / negative regulation of cell proliferation / neuropeptide signaling pathway / positive regulation of cytokinesis / regulation of insulin secretion / somatostatin signaling pathway / synaptic transmission
Components
cytoplasm / integral component of plasma membrane / neuron projection / nucleus / plasma membrane
General Function
Somatostatin receptor activity
Specific Function
Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization.
Pfam Domain Function
Transmembrane Regions
39-66 77-101 114-135 158-178 198-222 248-273 284-308
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016699|Somatostatin receptor type 5 (SSTR5)
ATGGAGCCCCTGTTCCCAGCCTCCACGCCCAGCTGGAACGCCTCCTCCCCGGGGGCTGCC
TCTGGAGGCGGTGACAACAGGACGCTGGTGGGGCCGGCGCCCTCGGCAGGGGCCCGGGCG
GTGCTGGTGCCCGTGCTGTACCTGCTGGTGTGTGCGGCCGGGCTGGGCGGGAACACGCTG
GTCATCTACGTGGTGCTGCGCTTCGCCAAGATGAAGACCGTCACCAACATCTACATTCTC
AACCTGGCAGTGGCCGACGTCCTGTACATGCTGGGGCTGCCTTTCCTGGCCACGCAGAAC
GCCGCGTCCTTCTGGCCCTTCGGCCCCGTCCTGTGCCGCCTGGTCATGACGCTGGACGGC
GTCAACCAGTTCACCAGTGTCTTCTGCCTGACAGTCATGAGCGTGGACCGCTACCTGGCA
GTGGTGCACCCGCTGAGCTCGGCCCGCTGGCGCCGCCCGCGTGTGGCCAAGCTGGCGAGC
GCCGCGGCCTGGGTCCTGTCTCTGTGCATGTCGCTGCCGCTCCTGGTGTTCGCGGACGTG
CAGGAGGGCGGTACCTGCAACGCCAGCTGGCCGGAGCCCGTGGGGCTGTGGGGCGCCGTC
TTCATCATCTACACGGCCGTGCTGGGCTTCTTCGCGCCGCTGCTGGTCATCTGCCTGTGC
TACCTGCTCATCGTGGTGAAGGTGAGGGCGGCGGGCGTGCGCGTGGGCTGCGTGCGGCGG
CGCTCGGAGCGGAAGGTGACGCGCATGGTGTTGGTGGTGGTGCTGGTGTTTGCGGGATGT
TGGCTGCCCTTCTTCACCGTCAACATCGTCAACCTGGCCGTGGCGCTGCCCCAGGAGCCC
GCCTCCGCCGGCCTCTACTTCTTCGTGGTCATCCTCTCCTACGCCAACAGCTGTGCCAAC
CCCGTCCTCTACGGCTTCCTCTCTGACAACTTCCGCCAGAGCTTCCAGAAGGTTCTGTGC
CTCCGCAAGGGCTCTGGTGCCAAGGACGCTGACGCCACGGAGCCGCGTCCAGACAGGATC
CGGCAGCAGCAGGAGGCCACGCCACCCGCGCACCGCGCCGCAGCCAACGGGCTTATGCAG
ACCAGCAAGCTGTGA
Chromosome Location
16
Locus
16p13.3
External Identifiers
ResourceLink
UniProtKB IDP35346
UniProtKB Entry NameSSR5_HUMAN
GenBank Protein ID431095
GenBank Gene IDL14865
GenAtlas IDSSTR5
HGNC IDHGNC:11334
General References
  1. Panetta R, Greenwood MT, Warszynska A, Demchyshyn LL, Day R, Niznik HB, Srikant CB, Patel YC: Molecular cloning, functional characterization, and chromosomal localization of a human somatostatin receptor (somatostatin receptor type 5) with preferential affinity for somatostatin-28. Mol Pharmacol. 1994 Mar;45(3):417-27. [PubMed:7908405]
  2. Yamada Y, Kagimoto S, Kubota A, Yasuda K, Masuda K, Someya Y, Ihara Y, Li Q, Imura H, Seino S, et al.: Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype. Biochem Biophys Res Commun. 1993 Sep 15;195(2):844-52. [PubMed:8373420]
  3. O'Carroll AM, Raynor K, Lolait SJ, Reisine T: Characterization of cloned human somatostatin receptor SSTR5. Mol Pharmacol. 1994 Aug;46(2):291-8. [PubMed:8078491]
  4. Petersenn S, Rasch AC, Bohnke C, Schulte HM: Identification of an upstream pituitary-active promoter of human somatostatin receptor subtype 5. Endocrinology. 2002 Jul;143(7):2626-34. [PubMed:12072395]
  5. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. [PubMed:11157797]
  6. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  7. Grant M, Alturaihi H, Jaquet P, Collier B, Kumar U: Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Mol Endocrinol. 2008 Oct;22(10):2278-92. doi: 10.1210/me.2007-0334. Epub 2008 Jul 24. [PubMed:18653781]
  8. Kokkola T, Kruse C, Roy-Pogodzik EM, Pekkinen J, Bauch C, Honck HH, Hennemann H, Kreienkamp HJ: Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase. FEBS Lett. 2011 Sep 2;585(17):2665-70. doi: 10.1016/j.febslet.2011.07.028. Epub 2011 Jul 31. [PubMed:21820437]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00104Octreotideapproved, investigationalyesDetails
DB06663PasireotideapprovedunknownDetails
DB04894Vapreotideexperimental, investigationalyesagonistDetails
DB06791LanreotideapprovedunknownagonistDetails
DB13985Lutetium Lu 177 dotatateapproved, investigationalyesagonistDetails
DB09099Somatostatinapproved, investigationalyesagonistDetails