Alpha-1B adrenergic receptor

Details

Name
Alpha-1B adrenergic receptor
Synonyms
  • Alpha-1B adrenoceptor
  • Alpha-1B adrenoreceptor
Gene Name
ADRA1B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010399|Alpha-1B adrenergic receptor
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Number of residues
520
Molecular Weight
56835.375
Theoretical pI
9.79
GO Classification
Functions
alpha1-adrenergic receptor activity / protein heterodimerization activity
Processes
adenylate cyclase-activating adrenergic receptor signaling pathway / adenylate cyclase-modulating G-protein coupled receptor signaling pathway / adult heart development / behavioral response to cocaine / blood vessel remodeling / cell growth / cell proliferation / cell-cell signaling / G-protein coupled receptor signaling pathway / glucose homeostasis / intracellular signal transduction / locomotory behavior / multicellular organismal development / negative regulation of glycogen catabolic process / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / organ growth / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of cytosolic calcium ion concentration / positive regulation of glycogen catabolic process / positive regulation of heart rate by epinephrine-norepinephrine / positive regulation of MAPK cascade / positive regulation of smooth muscle contraction / positive regulation of the force of heart contraction by epinephrine-norepinephrine / positive regulation of vasoconstriction / regulation of cardiac muscle contraction / response to amphetamine / response to morphine / vasoconstriction of artery involved in baroreceptor response to lowering of systemic arterial blood pressure / visual learning
Components
cytosol / integral component of plasma membrane / nuclear membrane / nucleus / plasma membrane
General Function
Protein heterodimerization activity
Specific Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
Pfam Domain Function
Transmembrane Regions
46-70 84-105 116-141 162-184 202-224 296-319 327-351
Cellular Location
Nucleus membrane
Gene sequence
>lcl|BSEQ0010400|Alpha-1B adrenergic receptor (ADRA1B)
ATGAATCCCGACCTGGACACCGGCCACAACACATCAGCACCTGCCCACTGGGGAGAGTTG
AAAAATGCCAACTTCACTGGCCCCAACCAGACCTCGAGCAACTCCACACTGCCCCAGCTG
GACATCACCAGGGCCATCTCTGTGGGCCTGGTGCTGGGCGCCTTCATCCTCTTTGCCATC
GTGGGCAACATCCTAGTCATCTTGTCTGTGGCCTGCAACCGGCACCTGCGGACGCCCACC
AACTACTTCATTGTCAACCTGGCCATGGCCGACCTGCTGTTGAGCTTCACCGTCCTGCCC
TTCTCAGCGGCCCTAGAGGTGCTCGGCTACTGGGTGCTGGGGCGGATCTTCTGTGACATC
TGGGCAGCCGTGGATGTCCTGTGCTGCACAGCGTCCATTCTGAGCCTGTGCGCCATCTCC
ATCGATCGCTACATCGGGGTGCGCTACTCTCTGCAGTATCCCACGCTGGTCACCCGGAGG
AAGGCCATCTTGGCGCTGCTCAGTGTCTGGGTCTTGTCCACCGTCATCTCCATCGGGCCT
CTCCTTGGGTGGAAGGAGCCGGCACCCAACGATGACAAGGAGTGCGGGGTCACCGAAGAA
CCCTTCTATGCCCTCTTCTCCTCTCTGGGCTCCTTCTACATCCCTCTGGCGGTCATTCTA
GTCATGTACTGCCGTGTCTATATAGTGGCCAAGAGAACCACCAAGAACCTAGAGGCAGGA
GTCATGAAGGAGATGTCCAACTCCAAGGAGCTGACCCTGAGGATCCATTCCAAGAACTTT
CACGAGGACACCCTTAGCAGTACCAAGGCCAAGGGCCACAACCCCAGGAGTTCCATAGCT
GTCAAACTTTTTAAGTTCTCCAGGGAAAAGAAAGCAGCTAAGACGTTGGGCATTGTGGTC
GGTATGTTCATCTTGTGCTGGCTACCCTTCTTCATCGCTCTACCGCTTGGCTCCTTGTTC
TCCACCCTGAAGCCCCCCGACGCCGTGTTCAAGGTGGTGTTCTGGCTGGGCTACTTCAAC
AGCTGCCTCAACCCCATCATCTACCCATGCTCCAGCAAGGAGTTCAAGCGCGCTTTCGTG
CGCATCCTCGGGTGCCAGTGCCGCGGCCGCGGCCGCCGCCGACGCCGCCGCCGCCGTCGC
CTGGGCGGCTGCGCCTACACCTACCGGCCGTGGACGCGCGGCGGCTCGCTGGAGCGCTCG
CAGTCGCGCAAGGACTCGCTGGACGACAGCGGCAGCTGCCTGAGCGGCAGCCAGCGGACC
CTGCCCTCGGCCTCGCCGAGCCCGGGCTACCTGGGCCGCGGCGCGCCACCGCCAGTCGAG
CTGTGCGCCTTCCCCGAGTGGAAGGCGCCCGGCGCCCTCCTGAGCCTGCCCGCGCCTGAG
CCCCCCGGCCGCCGCGGCCGCCACGACTCGGGCCCGCTCTTCACCTTCAAGCTCCTGACC
GAGCCCGAGAGCCCCGGGACCGACGGCGGCGCCAGCAACGGAGGCTGCGAGGCCGCGGCC
GACGTGGCCAACGGGCAGCCGGGCTTCAAAAGCAACATGCCCCTGGCGCCCGGGCAGTTT
TAG
Chromosome Location
5
Locus
5q23-q32
External Identifiers
ResourceLink
UniProtKB IDP35368
UniProtKB Entry NameADA1B_HUMAN
GenBank Gene IDM99589
GenAtlas IDADRA1B
HGNC IDHGNC:278
General References
  1. Ramarao CS, Denker JM, Perez DM, Gaivin RJ, Riek RP, Graham RM: Genomic organization and expression of the human alpha 1B-adrenergic receptor. J Biol Chem. 1992 Oct 25;267(30):21936-45. [PubMed:1328250]
  2. Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed:8183249]
  3. Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed:7815325]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Wright CD, Chen Q, Baye NL, Huang Y, Healy CL, Kasinathan S, O'Connell TD: Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes. Circ Res. 2008 Oct 24;103(9):992-1000. doi: 10.1161/CIRCRESAHA.108.176024. Epub 2008 Sep 18. [PubMed:18802028]
  6. Wright CD, Wu SC, Dahl EF, Sazama AJ, O'Connell TD: Nuclear localization drives alpha1-adrenergic receptor oligomerization and signaling in cardiac myocytes. Cell Signal. 2012 Mar;24(3):794-802. doi: 10.1016/j.cellsig.2011.11.014. Epub 2011 Nov 18. [PubMed:22120526]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00298DapiprazoleapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00706Tamsulosinapproved, investigationalunknownantagonistDetails
DB00745Modafinilapproved, investigationalunknownpartial agonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB01162TerazosinapprovedyesantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00457PrazosinapprovedyesantagonistDetails
DB00723Methoxamineapproved, investigationalunknownagonistDetails
DB01608Periciazineapproved, investigationalunknownantagonistDetails
DB01576Dextroamphetamineapproved, illicitunknownantagonistDetails
DB01579Phendimetrazineapproved, illicitunknownagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00590DoxazosinapprovedyesantagonistDetails
DB00211MidodrineapprovedyesagonistDetails
DB01149Nefazodoneapproved, withdrawnunknownother/unknownDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB00388PhenylephrineapprovedyesDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB00346Alfuzosinapproved, investigationalyesantagonistDetails
DB04855DronedaroneapprovedunknownantagonistDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownDetails
DB05469R450investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownantagonistagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00726TrimipramineapprovedunknownantagonistDetails
DB00696Ergotamineapprovedyespartial agonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedyesantagonistDetails
DB00679Thioridazineapproved, withdrawnyesantagonistDetails
DB01614Acepromazineexperimental, vet_approvedunknownantagonistDetails
DB01622ThioproperazineexperimentalyesantagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB06207SilodosinapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownantagonistDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00575ClonidineapprovedunknownagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00800FenoldopamapprovedunknowninhibitorDetails
DB00248CabergolineapprovedunknownbinderDetails
DB00321AmitriptylineapprovedunknownantagonistDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB09202Cirazolineexperimentalyespartial agonistDetails
DB09128Brexpiprazoleapproved, investigationalyesantagonistDetails
DB00692PhentolamineapprovedunknownantagonistDetails
DB00908Quinidineapproved, investigationalunknownantagonistDetails
DB00661VerapamilapprovedunknownantagonistDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoantagonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00370MirtazapineapprovedunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB13025TiaprideinvestigationalyesantagonistDetails
DB08922PerospironeexperimentalunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB00841DobutamineapprovedyesagonistDetails
DB09203SynephrineexperimentalunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB09286PipamperoneinvestigationalunknownantagonistDetails
DB00243Ranolazineapproved, investigationalnoantagonistDetails
DB00457PrazosinapprovedunknownDetails
DB00697Tizanidineapproved, investigationalunknownagonistDetails
DB00433Prochlorperazineapproved, vet_approvedunknownantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229AranidipineexperimentalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB00268Ropiniroleapproved, investigationalunknownantagonistDetails