Tyrosine-protein kinase receptor Tie-1

Details

Name
Tyrosine-protein kinase receptor Tie-1
Synonyms
  • 2.7.10.1
  • TIE
Gene Name
TIE1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051670|Tyrosine-protein kinase receptor Tie-1
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Number of residues
1138
Molecular Weight
125088.595
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / transmembrane receptor protein tyrosine kinase activity
Processes
angiogenesis / in utero embryonic development / mesoderm development / negative regulation of angiogenesis / negative regulation of cell migration / plasma membrane fusion / response to retinoic acid / signal transduction / vasculogenesis
Components
integral component of plasma membrane
General Function
Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
760-784
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051671|Tyrosine-protein kinase receptor Tie-1 (TIE1)
ATGGTCTGGCGGGTGCCCCCTTTCTTGCTCCCCATCCTCTTCTTGGCTTCTCATGTGGGC
GCGGCGGTGGACCTGACGCTGCTGGCCAACCTGCGGCTCACGGACCCCCAGCGCTTCTTC
CTGACTTGCGTGTCTGGGGAGGCCGGGGCGGGGAGGGGCTCGGACGCCTGGGGCCCGCCC
CTGCTGCTGGAGAAGGACGACCGTATCGTGCGCACCCCGCCCGGGCCACCCCTGCGCCTG
GCGCGCAACGGTTCGCACCAGGTCACGCTTCGCGGCTTCTCCAAGCCCTCGGACCTCGTG
GGCGTCTTCTCCTGCGTGGGCGGTGCTGGGGCGCGGCGCACGCGCGTCATCTACGTGCAC
AACAGCCCTGGAGCCCACCTGCTTCCAGACAAGGTCACACACACTGTGAACAAAGGTGAC
ACCGCTGTACTTTCTGCACGTGTGCACAAGGAGAAGCAGACAGACGTGATCTGGAAGAGC
AACGGATCCTACTTCTACACCCTGGACTGGCATGAAGCCCAGGATGGGCGGTTCCTGCTG
CAGCTCCCAAATGTGCAGCCACCATCGAGCGGCATCTACAGTGCCACTTACCTGGAAGCC
AGCCCCCTGGGCAGCGCCTTCTTTCGGCTCATCGTGCGGGGTTGTGGGGCTGGGCGCTGG
GGGCCAGGCTGTACCAAGGAGTGCCCAGGTTGCCTACATGGAGGTGTCTGCCACGACCAT
GACGGCGAATGTGTATGCCCCCCTGGCTTCACTGGCACCCGCTGTGAACAGGCCTGCAGA
GAGGGCCGTTTTGGGCAGAGCTGCCAGGAGCAGTGCCCAGGCATATCAGGCTGCCGGGGC
CTCACCTTCTGCCTCCCAGACCCCTATGGCTGCTCTTGTGGATCTGGCTGGAGAGGAAGC
CAGTGCCAAGAAGCTTGTGCCCCTGGTCATTTTGGGGCTGATTGCCGACTCCAGTGCCAG
TGTCAGAATGGTGGCACTTGTGACCGGTTCAGTGGTTGTGTCTGCCCCTCTGGGTGGCAT
GGAGTGCACTGTGAGAAGTCAGACCGGATCCCCCAGATCCTCAACATGGCCTCAGAACTG
GAGTTCAACTTAGAGACGATGCCCCGGATCAACTGTGCAGCTGCAGGGAACCCCTTCCCC
GTGCGGGGCAGCATAGAGCTACGCAAGCCAGACGGCACTGTGCTCCTGTCCACCAAGGCC
ATTGTGGAGCCAGAGAAGACCACAGCTGAGTTCGAGGTGCCCCGCTTGGTTCTTGCGGAC
AGTGGGTTCTGGGAGTGCCGTGTGTCCACATCTGGCGGCCAAGACAGCCGGCGCTTCAAG
GTCAATGTGAAAGTGCCCCCCGTGCCCCTGGCTGCACCTCGGCTCCTGACCAAGCAGAGC
CGCCAGCTTGTGGTCTCCCCGCTGGTCTCGTTCTCTGGGGATGGACCCATCTCCACTGTC
CGCCTGCACTACCGGCCCCAGGACAGTACCATGGACTGGTCGACCATTGTGGTGGACCCC
AGTGAGAACGTGACGTTAATGAACCTGAGGCCAAAGACAGGATACAGTGTTCGTGTGCAG
CTGAGCCGGCCAGGGGAAGGAGGAGAGGGGGCCTGGGGGCCTCCCACCCTCATGACCACA
GACTGTCCTGAGCCTTTGTTGCAGCCGTGGTTGGAGGGCTGGCATGTGGAAGGCACTGAC
CGGCTGCGAGTGAGCTGGTCCTTGCCCTTGGTGCCCGGGCCACTGGTGGGCGACGGTTTC
CTGCTGCGCCTGTGGGACGGGACACGGGGGCAGGAGCGGCGGGAGAACGTCTCATCCCCC
CAGGCCCGCACTGCCCTCCTGACGGGACTCACGCCTGGCACCCACTACCAGCTGGATGTG
CAGCTCTACCACTGCACCCTCCTGGGCCCGGCCTCGCCCCCTGCACACGTGCTTCTGCCC
CCCAGTGGGCCTCCAGCCCCCCGACACCTCCACGCCCAGGCCCTCTCAGACTCCGAGATC
CAGCTGACATGGAAGCACCCGGAGGCTCTGCCTGGGCCAATATCCAAGTACGTTGTGGAG
GTGCAGGTGGCTGGGGGTGCAGGAGACCCACTGTGGATAGACGTGGACAGGCCTGAGGAG
ACAAGCACCATCATCCGTGGCCTCAACGCCAGCACGCGCTACCTCTTCCGCATGCGGGCC
AGCATTCAGGGGCTCGGGGACTGGAGCAACACAGTAGAAGAGTCCACCCTGGGCAACGGG
CTGCAGGCTGAGGGCCCAGTCCAAGAGAGCCGGGCAGCTGAAGAGGGCCTGGATCAGCAG
CTGATCCTGGCGGTGGTGGGCTCCGTGTCTGCCACCTGCCTCACCATCCTGGCTGCCCTT
TTAACCCTGGTGTGCATCCGCAGAAGCTGCCTGCATCGGAGACGCACCTTCACCTACCAG
TCAGGCTCGGGCGAGGAGACCATCCTGCAGTTCAGCTCAGGGACCTTGACACTTACCCGG
CGGCCAAAACTGCAGCCCGAGCCCCTGAGCTACCCAGTGCTAGAGTGGGAGGACATCACC
TTTGAGGACCTCATCGGGGAGGGGAACTTCGGCCAGGTCATCCGGGCCATGATCAAGAAG
GACGGGCTGAAGATGAACGCAGCCATCAAAATGCTGAAAGAGTATGCCTCTGAAAATGAC
CATCGTGACTTTGCGGGAGAACTGGAAGTTCTGTGCAAATTGGGGCATCACCCCAACATC
ATCAACCTCCTGGGGGCCTGTAAGAACCGAGGTTACTTGTATATCGCTATTGAATATGCC
CCCTACGGGAACCTGCTAGATTTTCTGCGGAAAAGCCGGGTCCTAGAGACTGACCCAGCT
TTTGCTCGAGAGCATGGGACAGCCTCTACCCTTAGCTCCCGGCAGCTGCTGCGTTTCGCC
AGTGATGCGGCCAATGGCATGCAGTACCTGAGTGAGAAGCAGTTCATCCACAGGGACCTG
GCTGCCCGGAATGTGCTGGTCGGAGAGAACCTAGCCTCCAAGATTGCAGACTTCGGCCTT
TCTCGGGGAGAGGAGGTTTATGTGAAGAAGACGATGGGGCGTCTCCCTGTGCGCTGGATG
GCCATTGAGTCCCTGAACTACAGTGTCTATACCACCAAGAGTGATGTCTGGTCCTTTGGA
GTCCTTCTTTGGGAGATAGTGAGCCTTGGAGGTACACCCTACTGTGGCATGACCTGTGCC
GAGCTCTATGAAAAGCTGCCCCAGGGCTACCGCATGGAGCAGCCTCGAAACTGTGACGAT
GAAGTGTACGAGCTGATGCGTCAGTGCTGGCGGGACCGTCCCTATGAGCGACCCCCCTTT
GCCCAGATTGCGCTACAGCTAGGCCGCATGCTGGAAGCCAGGAAGGCCTATGTGAACATG
TCGCTGTTTGAGAACTTCACTTACGCGGGCATTGATGCCACAGCTGAGGAGGCCTGA
Chromosome Location
1
Locus
1p34.2
External Identifiers
ResourceLink
UniProtKB IDP35590
UniProtKB Entry NameTIE1_HUMAN
HGNC IDHGNC:11809
General References
  1. Partanen J, Armstrong E, Makela TP, Korhonen J, Sandberg M, Renkonen R, Knuutila S, Huebner K, Alitalo K: A novel endothelial cell surface receptor tyrosine kinase with extracellular epidermal growth factor homology domains. Mol Cell Biol. 1992 Apr;12(4):1698-707. [PubMed:1312667]
  2. Jin P, Zhang J, Sumariwalla PF, Ni I, Jorgensen B, Crawford D, Phillips S, Feldmann M, Shepard HM, Paleolog EM: Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. Arthritis Res Ther. 2008;10(4):R73. doi: 10.1186/ar2447. Epub 2008 Jul 1. [PubMed:18593464]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161]
  6. Saharinen P, Kerkela K, Ekman N, Marron M, Brindle N, Lee GM, Augustin H, Koh GY, Alitalo K: Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2. J Cell Biol. 2005 Apr 25;169(2):239-43. [PubMed:15851516]
  7. Seegar TC, Eller B, Tzvetkova-Robev D, Kolev MV, Henderson SC, Nikolov DB, Barton WA: Tie1-Tie2 interactions mediate functional differences between angiopoietin ligands. Mol Cell. 2010 Mar 12;37(5):643-55. doi: 10.1016/j.molcel.2010.02.007. [PubMed:20227369]
  8. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails