Monocarboxylate transporter 8

Details

Name
Monocarboxylate transporter 8
Synonyms
  • MCT 7
  • MCT 8
  • MCT8
  • Monocarboxylate transporter 7
  • Solute carrier family 16 member 2
  • X-linked PEST-containing transporter
  • XPCT
Gene Name
SLC16A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0000355|Monocarboxylate transporter 8
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPD
PAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNS
VGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAV
AFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSS
IFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLH
QRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLL
VCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFL
GLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAF
YFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Number of residues
539
Molecular Weight
59510.86
Theoretical pI
5.32
GO Classification
Functions
monocarboxylic acid transmembrane transporter activity / symporter activity / thyroid hormone transmembrane transporter activity / transporter activity
Processes
ion transmembrane transport / monocarboxylic acid transport / thyroid hormone transport / transport
Components
integral component of plasma membrane / membrane
General Function
Transporter activity
Specific Function
Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.
Pfam Domain Function
Transmembrane Regions
97-117 144-164 172-192 201-221 230-250 259-279 323-343 357-377 387-407 410-430 448-468 478-498
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009986|Monocarboxylate transporter 8 (SLC16A2)
ATGGCGCTGCAAAGCCAGGCGAGCGAGGAAGCAAAGGGGCCCTGGCAGGAGGCAGACCAG
GAACAGCAGGAGCCGGTGGGTAGCCCAGAGCCGGAGTCTGAGCCGGAGCCTGAGCCCGAG
CCCGAGCCCGTGCCAGTGCCCCCGCCCGAGCCCCAGCCGGAGCCCCAGCCCCTACCGGAC
CCCGCACCCCTGCCGGAGCTGGAGTTCGAGTCCGAGCGGGTGCACGAACCCGAGCCCACG
CCTACGGTAGAGACCCGCGGCACCGCGCGCGGCTTCCAGCCTCCCGAAGGTGGCTTCGGC
TGGGTGGTGGTGTTCGCTGCCACCTGGTGCAACGGCTCCATCTTCGGCATCCATAACTCT
GTCGGGATCCTCTACTCCATGCTGCTAGAGGAGGAAAAGGAAAAAAATCGCCAAGTGGAG
TTCCAAGCAGCATGGGTCGGAGCCCTCGCGATGGGTATGATCTTCTTCTGTTCTCCCATT
GTGAGTATATTCACTGACCGTTTGGGCTGCCGAATCACAGCAACCGCGGGGGCTGCCGTT
GCTTTCATTGGCCTCCATACCAGCTCCTTCACCAGCTCCCTAAGCCTGCGCTACTTCACC
TACGGGATTCTCTTTGGTTGTGGCTGTTCCTTCGCCTTTCAGCCATCCCTCGTCATCCTG
GGCCACTACTTTCAACGCCGCCTGGGTCTGGCCAATGGTGTGGTGTCTGCTGGGAGTAGC
ATTTTCTCCATGTCCTTCCCCTTCCTCATCAGAATGCTGGGGGATAAGATCAAGCTGGCC
CAAACCTTCCAGGTGCTGAGTACCTTCATGTTTGTTCTTATGCTGCTTTCACTCACCTAC
CGGCCCCTCCTGCCCAGCTCCCAGGACACCCCAAGCAAGAGAGGTGTCCGCACCCTGCAC
CAGCGCTTTCTGGCTCAGCTCAGGAAGTACTTCAACATGCGAGTGTTCCGCCAACGCACT
TACCGCATCTGGGCCTTCGGAATTGCTGCTGCTGCCCTTGGCTACTTTGTTCCCTATGTA
CACCTGATGAAGTATGTGGAGGAGGAGTTCTCAGAAATCAAGGAGACCTGGGTGCTCTTG
GTGTGTATTGGGGCTACCTCAGGCCTTGGGCGTCTTGTGTCAGGCCACATCAGTGACTCC
ATCCCTGGACTTAAGAAGATCTACTTGCAGGTCCTTTCCTTCCTGCTCCTGGGCCTGATG
TCCATGATGATTCCCCTGTGCCGGGACTTCGGGGGCCTTATCGTCGTCTGTCTTTTCCTG
GGCCTTTGCGATGGCTTCTTCATCACCATCATGGCCCCCATTGCATTTGAGCTGGTGGGC
CCAATGCAGGCCTCACAGGCCATTGGCTACCTCCTGGGCATGATGGCCCTGCCAATGATT
GCTGGGCCCCCCATTGCAGGCCTACTCCGCAACTGTTTTGGGGACTACCATGTGGCCTTC
TACTTTGCCGGTGTGCCCCCCATCATCGGGGCTGTAATCCTCTTCTTCGTCCCTCTGATG
CATCAAAGGATGTTCAAGAAAGAGCAGAGAGATTCCAGCAAGGATAAGATGTTGGCCCCT
GACCCAGACCCCAATGGGGAGCTACTGCCGGGCTCCCCCAACCCTGAGGAACCAATCTAA
Chromosome Location
X
Locus
Xq13.2
External Identifiers
ResourceLink
UniProtKB IDP36021
UniProtKB Entry NameMOT8_HUMAN
GenBank Protein ID458255
GenBank Gene IDU05321
GenAtlas IDSLC16A2
HGNC IDHGNC:10923
General References
  1. Lafreniere RG, Carrel L, Willard HF: A novel transmembrane transporter encoded by the XPCT gene in Xq13.2. Hum Mol Genet. 1994 Jul;3(7):1133-9. [PubMed:7981683]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  4. Visser WE, Philp NJ, van Dijk TB, Klootwijk W, Friesema EC, Jansen J, Beesley PW, Ianculescu AG, Visser TJ: Evidence for a homodimeric structure of human monocarboxylate transporter 8. Endocrinology. 2009 Nov;150(11):5163-70. doi: 10.1210/en.2009-0699. Epub 2009 Sep 24. [PubMed:19797118]
  5. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [PubMed:22223895]
  6. Groeneweg S, Lima de Souza EC, Visser WE, Peeters RP, Visser TJ: Importance of His192 in the human thyroid hormone transporter MCT8 for substrate recognition. Endocrinology. 2013 Jul;154(7):2525-32. doi: 10.1210/en.2012-2225. Epub 2013 Apr 22. [PubMed:23610131]
  7. Dumitrescu AM, Liao XH, Best TB, Brockmann K, Refetoff S: A novel syndrome combining thyroid and neurological abnormalities is associated with mutations in a monocarboxylate transporter gene. Am J Hum Genet. 2004 Jan;74(1):168-75. Epub 2003 Dec 5. [PubMed:14661163]
  8. Frints SG, Lenzner S, Bauters M, Jensen LR, Van Esch H, des Portes V, Moog U, Macville MV, van Roozendaal K, Schrander-Stumpel CT, Tzschach A, Marynen P, Fryns JP, Hamel B, van Bokhoven H, Chelly J, Beldjord C, Turner G, Gecz J, Moraine C, Raynaud M, Ropers HH, Froyen G, Kuss AW: MCT8 mutation analysis and identification of the first female with Allan-Herndon-Dudley syndrome due to loss of MCT8 expression. Eur J Hum Genet. 2008 Sep;16(9):1029-37. doi: 10.1038/ejhg.2008.66. Epub 2008 Apr 9. [PubMed:18398436]
  9. Friesema EC, Grueters A, Biebermann H, Krude H, von Moers A, Reeser M, Barrett TG, Mancilla EE, Svensson J, Kester MH, Kuiper GG, Balkassmi S, Uitterlinden AG, Koehrle J, Rodien P, Halestrap AP, Visser TJ: Association between mutations in a thyroid hormone transporter and severe X-linked psychomotor retardation. Lancet. 2004 Oct 16-22;364(9443):1435-7. [PubMed:15488219]
  10. Schwartz CE, May MM, Carpenter NJ, Rogers RC, Martin J, Bialer MG, Ward J, Sanabria J, Marsa S, Lewis JA, Echeverri R, Lubs HA, Voeller K, Simensen RJ, Stevenson RE: Allan-Herndon-Dudley syndrome and the monocarboxylate transporter 8 (MCT8) gene. Am J Hum Genet. 2005 Jul;77(1):41-53. Epub 2005 May 11. [PubMed:15889350]
  11. Visser WE, Jansen J, Friesema EC, Kester MH, Mancilla E, Lundgren J, van der Knaap MS, Lunsing RJ, Brouwer OF, Visser TJ: Novel pathogenic mechanism suggested by ex vivo analysis of MCT8 (SLC16A2) mutations. Hum Mutat. 2009 Jan;30(1):29-38. doi: 10.1002/humu.20808. [PubMed:18636565]
  12. Kersseboom S, Kremers GJ, Friesema EC, Visser WE, Klootwijk W, Peeters RP, Visser TJ: Mutations in MCT8 in patients with Allan-Herndon-Dudley-syndrome affecting its cellular distribution. Mol Endocrinol. 2013 May;27(5):801-13. doi: 10.1210/me.2012-1356. Epub 2013 Apr 2. [PubMed:23550058]
  13. Fischer J, Kleinau G, Muller A, Kuhnen P, Zwanziger D, Kinne A, Rehders M, Moeller LC, Fuhrer D, Gruters A, Krude H, Brix K, Biebermann H: Modulation of monocarboxylate transporter 8 oligomerization by specific pathogenic mutations. J Mol Endocrinol. 2015 Feb;54(1):39-50. doi: 10.1530/JME-14-0272. [PubMed:25527620]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00119Pyruvic acidapproved, investigational, nutraceuticalunknownDetails
DB00451LevothyroxineapprovedunknowninhibitorDetails
DB00135Tyrosineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00150Tryptophanapproved, nutraceutical, withdrawnunknowninhibitorDetails
DB00149Leucineinvestigational, nutraceuticalunknownsubstrateDetails
DB01583LiotrixapprovedunknowninhibitorDetails
DB09100Thyroid, porcineapprovedunknownsubstrateDetails