Neuronal acetylcholine receptor subunit alpha-7

Details

Name
Neuronal acetylcholine receptor subunit alpha-7
Synonyms
  • NACHRA7
Gene Name
CHRNA7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004597|Neuronal acetylcholine receptor subunit alpha-7
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Number of residues
502
Molecular Weight
56448.925
Theoretical pI
6.44
GO Classification
Functions
acetylcholine binding / acetylcholine receptor activity / acetylcholine-activated cation-selective channel activity / acetylcholine-gated cation channel activity / beta-amyloid binding / chloride channel regulator activity / drug binding / protein homodimerization activity / toxic substance binding
Processes
activation of MAPK activity / associative learning / B cell activation / behavioral response to ethanol / behavioral response to nicotine / calcium ion transport / cation transmembrane transport / cellular calcium ion homeostasis / cognition / dopamine biosynthetic process / endocytosis / generation of ovulation cycle rhythm / ion transmembrane transport / ion transport / memory / negative regulation of inflammatory response / negative regulation of interleukin-1 beta production / negative regulation of interleukin-6 production / negative regulation of tumor necrosis factor production / neuronal action potential / positive regulation of angiogenesis / positive regulation of cell proliferation / positive regulation of heart rate involved in baroreceptor response to decreased systemic arterial blood pressure / regulation of membrane potential / regulation of norepinephrine secretion / regulation of synaptic transmission, dopaminergic / response to food / response to hypoxia / response to nicotine / signal transduction / sperm motility / synaptic transmission / synaptic transmission, cholinergic / T cell activation
Components
acetylcholine-gated channel complex / apical plasma membrane / asymmetric synapse / axolemma / cell junction / cytoplasm / dendritic shaft / dendritic spine / external side of plasma membrane / growth cone / integral component of membrane / membrane raft / neuron projection / neuronal cell body / plasma membrane / postsynaptic density / postsynaptic membrane / presynaptic membrane / synapse
General Function
Toxic substance binding
Specific Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.
Pfam Domain Function
Transmembrane Regions
231-255 262-280 296-317 470-490
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0020606|Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7)
ATGCGCTGCTCGCCGGGAGGCGTCTGGCTGGCGCTGGCCGCGTCGCTCCTGCACGTGTCC
CTGCAAGGCGAGTTCCAGAGGAAGCTTTACAAGGAGCTGGTCAAGAACTACAATCCCTTG
GAGAGGCCCGTGGCCAATGACTCGCAACCACTCACCGTCTACTTCTCCCTGAGCCTCCTG
CAGATCATGGACGTGGATGAGAAGAACCAAGTTTTAACCACCAACATTTGGCTGCAAATG
TCTTGGACAGATCACTATTTACAGTGGAATGTGTCAGAATATCCAGGGGTGAAGACTGTT
CGTTTCCCAGATGGCCAGATTTGGAAACCAGACATTCTTCTCTATAACAGTGCTGATGAG
CGCTTTGACGCCACATTCCACACTAACGTGTTGGTGAATTCTTCTGGGCATTGCCAGTAC
CTGCCTCCAGGCATATTCAAGAGTTCCTGCTACATCGATGTACGCTGGTTTCCCTTTGAT
GTGCAGCACTGCAAACTGAAGTTTGGGTCCTGGTCTTACGGAGGCTGGTCCTTGGATCTG
CAGATGCAGGAGGCAGATATCAGTGGCTATATCCCCAATGGAGAATGGGACCTAGTGGGA
ATCCCCGGCAAGAGGAGTGAAAGGTTCTATGAGTGCTGCAAAGAGCCCTACCCCGATGTC
ACCTTCACAGTGACCATGCGCCGCAGGACGCTCTACTATGGCCTCAACCTGCTGATCCCC
TGTGTGCTCATCTCCGCCCTCGCCCTGCTGGTGTTCCTGCTTCCTGCAGATTCCGGGGAG
AAGATTTCCCTGGGGATAACAGTCTTACTCTCTCTTACCGTCTTCATGCTGCTCGTGGCT
GAGATCATGCCCGCAACATCCGATTCGGTACCATTGATAGCCCAGTACTTCGCCAGCACC
ATGATCATCGTGGGCCTCTCGGTGGTGGTGACAGTGATCGTGCTGCAGTACCACCACCAC
GACCCCGACGGGGGCAAGATGCCCAAGTGGACCAGAGTCATCCTTCTGAACTGGTGCGCG
TGGTTCCTGCGAATGAAGAGGCCCGGGGAGGACAAGGTGCGCCCGGCCTGCCAGCACAAG
CAGCGGCGCTGCAGCCTGGCCAGTGTGGAGATGAGCGCCGTGGCGCCGCCGCCCGCCAGC
AACGGGAACCTGCTGTACATCGGCTTCCGCGGCCTGGACGGCGTGCACTGTGTCCCGACC
CCCGACTCTGGGGTAGTGTGTGGCCGCATGGCCTGCTCCCCCACGCACGATGAGCACCTC
CTGCACGGCGGGCAACCCCCCGAGGGGGACCCGGACTTGGCCAAGATCCTGGAGGAGGTC
CGCTACATTGCCAACCGCTTCCGCTGCCAGGACGAAAGCGAGGCGGTCTGCAGCGAGTGG
AAGTTCGCCGCCTGTGTGGTGGACCGCCTGTGCCTCATGGCCTTCTCGGTCTTCACCATC
ATCTGCACCATCGGCATCCTGATGTCGGCTCCCAACTTCGTGGAGGCCGTGTCCAAAGAC
TTTGCGTAA
Chromosome Location
15
Locus
15q14
External Identifiers
ResourceLink
UniProtKB IDP36544
UniProtKB Entry NameACHA7_HUMAN
GenBank Protein ID496607
GenBank Gene IDX70297
GenAtlas IDCHRNA7
HGNC IDHGNC:1960
General References
  1. Peng X, Katz M, Gerzanich V, Anand R, Lindstrom J: Human alpha 7 acetylcholine receptor: cloning of the alpha 7 subunit from the SH-SY5Y cell line and determination of pharmacological properties of native receptors and functional alpha 7 homomers expressed in Xenopus oocytes. Mol Pharmacol. 1994 Mar;45(3):546-54. [PubMed:8145738]
  2. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. [PubMed:8906617]
  3. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. [PubMed:9009220]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Chini B, Raimond E, Elgoyhen AB, Moralli D, Balzaretti M, Heinemann S: Molecular cloning and chromosomal localization of the human alpha 7-nicotinic receptor subunit gene (CHRNA7). Genomics. 1994 Jan 15;19(2):379-81. [PubMed:8188270]
  8. Riley B, Williamson M, Collier D, Wilkie H, Makoff A: A 3-Mb map of a large Segmental duplication overlapping the alpha7-nicotinic acetylcholine receptor gene (CHRNA7) at human 15q13-q14. Genomics. 2002 Feb;79(2):197-209. [PubMed:11829490]
  9. Harris RA, Yang A, Stein RC, Lucy K, Brusten L, Herath A, Parekh R, Waterfield MD, O'Hare MJ, Neville MA, Page MJ, Zvelebil MJ: Cluster analysis of an extensive human breast cancer cell line protein expression map database. Proteomics. 2002 Feb;2(2):212-23. [PubMed:11840567]
  10. Williams ME, Burton B, Urrutia A, Shcherbatko A, Chavez-Noriega LE, Cohen CJ, Aiyar J: Ric-3 promotes functional expression of the nicotinic acetylcholine receptor alpha7 subunit in mammalian cells. J Biol Chem. 2005 Jan 14;280(2):1257-63. Epub 2004 Oct 25. [PubMed:15504725]
  11. Lansdell SJ, Gee VJ, Harkness PC, Doward AI, Baker ER, Gibb AJ, Millar NS: RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells. Mol Pharmacol. 2005 Nov;68(5):1431-8. Epub 2005 Aug 24. [PubMed:16120769]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00184NicotineapprovedyesagonistDetails
DB05708GTS-21investigationalunknownDetails
DB05740RPI-78MinvestigationalunknownDetails
DB01273Vareniclineapproved, investigationalunknownagonistDetails
DB01351Amobarbitalapproved, illicitunknownantagonistDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknownantagonistDetails
DB00237Butabarbitalapproved, illicitunknownantagonistDetails
DB00241Butalbitalapproved, illicitunknownantagonistDetails
DB00306Talbutalapproved, illicitunknownantagonistDetails
DB00418Secobarbitalapproved, vet_approvedunknownantagonistDetails
DB00463MetharbitalwithdrawnunknownantagonistDetails
DB00599Thiopentalapproved, vet_approvedunknownantagonistDetails
DB00794Primidoneapproved, vet_approvedunknownantagonistDetails
DB00849MethylphenobarbitalapprovedunknownantagonistDetails
DB01174Phenobarbitalapproved, investigationalunknownantagonistDetails
DB01352Aprobarbitalexperimental, illicitunknownantagonistDetails
DB01353Butobarbitalapproved, illicitunknownantagonistDetails
DB01354HeptabarbitalexperimentalunknownantagonistDetails
DB01355HexobarbitalexperimentalunknownantagonistDetails
DB01483BarbitalillicitunknownantagonistDetails
DB01496Barbituric acid derivativeexperimental, illicitunknownantagonistDetails
DB00674Galantamineapprovedunknownallosteric modulatorDetails
DB00514DextromethorphanapprovedunknownantagonistDetails
DB09028CytisineexperimentalunknownagonistDetails
DB00898EthanolapprovedunknownDetails
DB05137LobelineinvestigationalunknownDetails
DB00657Mecamylamineapproved, investigationalunknownDetails
DB01199TubocurarineapprovedunknownDetails
DB03128Acetylcholineapproved, investigationalunknownDetails
DB00122Cholineapproved, nutraceuticalunknownDetails
DB07720EpibatidineexperimentalunknownDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB14006Choline salicylateapproved, nutraceuticalunknownDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11726Enceniclineinvestigationalyespartial agonistDetails
DB00915AmantadineapprovedunknownantagonistDetails
DB00333MethadoneapprovedyesagonistDetails