Endoglucanase F

Details

Name
Endoglucanase F
Synonyms
  • 3.2.1.4
  • Cellulase F
  • EGCCF
  • Endo-1,4-beta-glucanase F
Gene Name
celCCF
Organism
Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Amino acid sequence
>lcl|BSEQ0010932|Endoglucanase F
MSKNFKRVGAVAVAAAMSLSIMATTSINAASSPANKVYQDRFESMYSKIKDPANGYFSEQ
GIPYHSIETLMVEAPDYGHVTTSEAMSYYMWLEAMHGRFSGDFTGFDKSWSVTEQYLIPT
EKDQPNTSMSRYDANKPATYAPEFQDPSKYPSPLDTSQPVGRDPINSQLTSAYGTSMLYG
MHWILDVDNWYGFGARADGTSKPSYINTFQRGEQESTWETIPQPCWDEHKFGGQYGFLDL
FTKDTGTPAKQFKYTNAPDADARAVQATYWADQWAKEQGKSVSTSVGKATKMGDYLRYSF
FDKYFRKIGQPSQAGTGYDAAHYLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQNPFAAWV
LSTDANFKPKSSNGASDWAKSLDRQLEFYQWLQSAEGAIAGGATNSWNGRYEAVPSGTST
FYGMGYVENPVYADPGSNTWFGMQVWSMQRVAELYYKTGDARAKKLLDKWAKWINGEIKF
NADGTFQIPSTIDWEGQPDTWNPTQGYTGNANLHVKVVNYGTDLGCASSLANTLTYYAAK
SGDETSRQNAQKLLDAMWNNYSDSKGISTVEQRGDYHRFLDQEVFVPAGWTGKMPNGDVI
KSGVKFIDIRSKYKQDPEWQTMVAALQAGQVPTQRLHRFWAQSEFAVANGVYAILFPDQG
PEKLLGDVNGDETVDAIDLAILKKYLLNSSTTINTANADMNSDNAIDAIDYALLKKALLS
IQ
Number of residues
722
Molecular Weight
80543.885
Theoretical pI
5.19
GO Classification
Functions
cellulase activity
Processes
cellulose catabolic process
General Function
Cellulase activity
Specific Function
Probable endoglucanase involved in the degradation of cellulose or related beta-glucans.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0010933|Endoglucanase F (celCCF)
ATGAGTAAGAATTTTAAAAGAGTAGGAGCAGTTGCAGTTGCTGCTGCAATGTCATTATCT
ATAATGGCAACAACCAGCATAAATGCAGCTTCAAGTCCTGCAAACAAGGTGTACCAGGAT
CGTTTTGAATCCATGTACAGCAAGATTAAGGATCCTGCAAACGGATACTTCAGTGAACAG
GGAATTCCTTACCACTCAATTGAAACACTGATGGTCGAAGCTCCTGACTACGGACATGTT
ACAACAAGTGAAGCTATGTCCTATTATATGTGGTTGGAAGCAATGCACGGAAGATTTTCA
GGAGATTTTACAGGTTTTGATAAGTCTTGGTCTGTTACCGAACAGTATTTGATCCCAACA
GAAAAGGATCAGCCCAATACAAGTATGAGCAGATATGATGCTAACAAACCGGCTACATAC
GCTCCGGAATTTCAGGACCCAAGCAAGTATCCTTCTCCGTTGGATACTAGTCAACCTGTT
GGTAGAGATCCAATCAACTCACAATTGACTTCAGCATACGGAACAAGCATGCTGTATGGA
ATGCACTGGATACTTGACGTTGATAACTGGTATGGATTTGGAGCAAGAGCTGATGGAACC
TCCAAGCCATCATATATCAATACTTTCCAAAGAGGTGAGCAGGAGTCAACTTGGGAAACC
ATACCTCAACCATGTTGGGATGAACATAAATTTGGTGGACAGTACGGATTCCTGGATCTC
TTTACAAAGGATACAGGTACTCCGGCAAAGCAATTCAAATATACAAATGCTCCAGATGCT
GATGCTCGTGCAGTTCAAGCAACTTACTGGGCTGATCAGTGGGCAAAAGAACAAGGTAAG
AGCGTAAGTACTAGCGTAGGTAAGGCAACAAAGATGGGTGATTACCTTAGATATTCATTC
TTTGATAAGTATTTCAGAAAGATCGGACAACCTTCTCAGGCTGGTACCGGATATGATGCA
GCACATTATCTGCTTTCATGGTACTATGCATGGGGTGGTGGAATTGACTCTACCTGGTCT
TGGATAATCGGTAGCAGTCATAATCATTTCGGTTACCAGAACCCATTTGCAGCTTGGGTA
CTTTCAACAGATGCAAACTTCAAGCCTAAGTCATCAAATGGTGCATCAGACTGGGCAAAG
AGTTTGGACAGACAGCTTGAATTCTATCAGTGGTTGCAGTCAGCAGAAGGTGCTATTGCC
GGTGGAGCTACAAACTCATGGAACGGACGTTATGAAGCAGTTCCTTCAGGTACATCAACA
TTCTATGGAATGGGTTATGTAGAAAACCCTGTATATGCTGACCCAGGTAGTAACACTTGG
TTTGGTATGCAGGTATGGTCAATGCAGCGTGTAGCTGAATTGTACTATAAGACTGGCGAT
GCCAGAGCTAAGAAACTCTTAGACAAATGGGCAAAATGGATTAATGGCGAAATCAAGTTC
AATGCTGACGGAACATTCCAGATTCCTAGCACAATTGATTGGGAAGGACAGCCGGATACT
TGGAATCCAACACAGGGATACACCGGAAATGCAAACTTGCATGTTAAAGTTGTTAACTAT
GGTACTGACCTAGGTTGTGCTTCTTCACTTGCAAACACATTGACTTACTATGCTGCTAAA
TCAGGAGATGAAACTTCAAGGCAGAATGCACAGAAATTACTTGACGCTATGTGGAATAAC
TATAGCGATTCAAAGGGTATATCAACTGTTGAACAGCGTGGTGATTACCATAGATTCCTT
GATCAGGAAGTTTTTGTACCAGCTGGTTGGACTGGAAAAATGCCTAACGGCGACGTAATC
AAATCTGGTGTCAAGTTCATAGACATTCGTTCCAAGTACAAGCAGGATCCTGAATGGCAG
ACAATGGTTGCTGCATTACAGGCAGGACAGGTTCCAACTCAGAGATTACACCGTTTCTGG
GCTCAGAGTGAATTTGCAGTTGCAAATGGAGTTTATGCAATACTCTTCCCAGATCAAGGT
CCAGAAAAATTATTGGGTGATGTAAACGGTGACGAAACTGTAGACGCTATTGACCTTGCT
ATACTTAAAAAATATCTTTTAAACAGCAGTACTACAATAAATACTGCAAATGCAGATATG
AATAGTGATAATGCTATTGACGCTATTGACTATGCTCTTTTAAAGAAAGCACTTCTTTCT
ATCCAATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP37698
UniProtKB Entry NameGUNF_CLOCE
GenBank Protein ID927292
GenBank Gene IDU30321
General References
  1. Reverbel-Leroy C, Belaich A, Bernadac A, Gaudin C, Belaich JP, Tardif C: Molecular study and overexpression of the Clostridium cellulolyticum celF cellulase gene in Escherichia coli. Microbiology. 1996 Apr;142 ( Pt 4):1013-23. [PubMed:8936327]
  2. Bagnara-Tardif C, Gaudin C, Belaich A, Hoest P, Citard T, Belaich JP: Sequence analysis of a gene cluster encoding cellulases from Clostridium cellulolyticum. Gene. 1992 Sep 21;119(1):17-28. [PubMed:1398087]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01642methyl beta-D-glucopyranosideexperimentalunknownDetails
DB02252IodophenylexperimentalunknownDetails
DB035844-Thio-beta-D-glucopyranoseexperimentalunknownDetails
DB038571,4-dithio-beta-D-glucopyranoseexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails