GTP-binding nuclear protein Ran
Details
- Name
- GTP-binding nuclear protein Ran
- Synonyms
- GTPase Ran
- Ras-like protein TC4
- Gene Name
- Not Available
- Organism
- Plasmodium falciparum
- Amino acid sequence
>lcl|BSEQ0051517|GTP-binding nuclear protein Ran MDSQEYIPQYKLILVGDGGVGKTTFVKRHLTGEFEKKYIPTLGVEVHPLKFQTNFGKTQF NVWDTAGQEKFGGLRDGYYIKSDCAIIMFDVSSRITYKNVPNWYRDITRVCETIPMVLVG NKVDVKDRQVKSRQIQFHRKRNLQYYDLSARSNYNFEKPFLWLARRLSNQPNLVFVGEHA KAPEFQIDLNIVREAEKELEQAAAVAIDEEDIEN
- Number of residues
- 214
- Molecular Weight
- 24875.185
- Theoretical pI
- Not Available
- GO Classification
- FunctionsGTP binding / GTPase activityProcessesnucleocytoplasmic transport / protein transportComponentsnucleus
- General Function
- GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
- Specific Function
- Gtp binding
- Pfam Domain Function
- Ras (PF00071)
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P38545 UniProtKB Entry Name RAN_PLAFA - General References
- Dontfraid FF, Chakrabarti D: Cloning and expression of a cDNA encoding the homologue of Ran/TC4 GTP-binding protein from Plasmodium falciparum. Biochem Biophys Res Commun. 1994 May 30;201(1):423-9. doi: 10.1006/bbrc.1994.1718. [Article]
- Sultan AA, Richardson WA, Alano P, Arnot DE, Doerig C: Cloning and characterisation of a Plasmodium falciparum homologue of the Ran/TC4 signal transducing GTPase involved in cell cycle control. Mol Biochem Parasitol. 1994 Jun;65(2):331-8. [Article]