Porin
Details
- Name
- Porin
- Synonyms
- Not Available
- Gene Name
- opmA
- Organism
- Rhodobacter blasticus
- Amino acid sequence
>lcl|BSEQ0011163|Porin EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDA FAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSK YDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAA YTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAY VSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
- Number of residues
- 289
- Molecular Weight
- 30596.82
- Theoretical pI
- 3.62
- GO Classification
- Functionsporin activityProcessesion transportComponentscell outer membrane / pore complex
- General Function
- Porin activity
- Specific Function
- Forms channels that allow the passive diffusion of small hydrophilic solutes up to an exclusion limit of about 0.6 kDa.
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell outer membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P39767 UniProtKB Entry Name PORI_RHOBL - General References
- Kreusch A, Neubuser A, Schiltz E, Weckesser J, Schulz GE: Structure of the membrane channel porin from Rhodopseudomonas blastica at 2.0 A resolution. Protein Sci. 1994 Jan;3(1):58-63. [Article]
- Kreusch A, Schulz GE: Refined structure of the porin from Rhodopseudomonas blastica. Comparison with the porin from Rhodobacter capsulatus. J Mol Biol. 1994 Nov 11;243(5):891-905. [Article]
- Schmid B, Maveyraud L, Kromer M, Schulz GE: Porin mutants with new channel properties. Protein Sci. 1998 Jul;7(7):1603-11. [Article]