Kappa-type opioid receptor
Details
- Name
- Kappa-type opioid receptor
- Synonyms
- K-OR-1
- OPRK
- Gene Name
- OPRK1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001260|Kappa-type opioid receptor MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV
- Number of residues
- 380
- Molecular Weight
- 42644.665
- Theoretical pI
- 7.79
- GO Classification
- Functionsdynorphin receptor activity / neuropeptide binding / opioid receptor activityProcessesadenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / adenylate cyclase-inhibiting opioid receptor signaling pathway / behavior / behavioral response to cocaine / cellular response to lipopolysaccharide / defense response to virus / eating behavior / estrous cycle / immune response / locomotory behavior / maternal behavior / negative regulation of luteinizing hormone secretion / neuropeptide signaling pathway / opioid receptor signaling pathway / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of dopamine secretion / positive regulation of locomotion / positive regulation of p38MAPK cascade / positive regulation of potassium ion transmembrane transport / regulation of aerobic respiration / regulation of energy homeostasis / regulation of saliva secretion / regulation of sensory perception of pain / response to acrylamide / response to estrogen / response to ethanol / response to insulin / response to morphine / response to radiation / sensory perception / sensory perception of pain / sensory perception of temperature stimulus / synaptic transmissionComponentsaxon terminus / dendrite / integral component of membrane / integral component of plasma membrane / neuron projection / perikaryon / plasma membrane / synapse
- General Function
- Opioid receptor activity
- Specific Function
- G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 58-85 96-119 133-154 174-196 223-247 275-296 312-333
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021645|Kappa-type opioid receptor (OPRK1) ATGGACTCCCCGATCCAGATCTTCCGCGGGGAGCCGGGCCCTACCTGCGCCCCGAGCGCC TGCCTGCCCCCCAACAGCAGCGCCTGGTTTCCCGGCTGGGCCGAGCCCGACAGCAACGGC AGCGCCGGCTCGGAGGACGCGCAGCTGGAGCCCGCGCACATCTCCCCGGCCATCCCGGTC ATCATCACGGCGGTCTACTCCGTAGTGTTCGTCGTGGGCTTGGTGGGCAACTCGCTGGTC ATGTTCGTGATCATCCGATACACAAAGATGAAGACAGCAACCAACATTTACATATTTAAC CTGGCTTTGGCAGATGCTTTAGTTACTACAACCATGCCCTTTCAGAGTACGGTCTACTTG ATGAATTCCTGGCCTTTTGGGGATGTGCTGTGCAAGATAGTAATTTCCATTGATTACTAC AACATGTTCACCAGCATCTTCACCTTGACCATGATGAGCGTGGACCGCTACATTGCCGTG TGCCACCCCGTGAAGGCTTTGGACTTCCGCACACCCTTGAAGGCAAAGATCATCAATATC TGCATCTGGCTGCTGTCGTCATCTGTTGGCATCTCTGCAATAGTCCTTGGAGGCACCAAA GTCAGGGAAGACGTCGATGTCATTGAGTGCTCCTTGCAGTTCCCAGATGATGACTACTCC TGGTGGGACCTCTTCATGAAGATCTGCGTCTTCATCTTTGCCTTCGTGATCCCTGTCCTC ATCATCATCGTCTGCTACACCCTGATGATCCTGCGTCTCAAGAGCGTCCGGCTCCTTTCT GGCTCCCGAGAGAAAGATCGCAACCTGCGTAGGATCACCAGACTGGTCCTGGTGGTGGTG GCAGTCTTCGTCGTCTGCTGGACTCCCATTCACATATTCATCCTGGTGGAGGCTCTGGGG AGCACCTCCCACAGCACAGCTGCTCTCTCCAGCTATTACTTCTGCATCGCCTTAGGCTAT ACCAACAGTAGCCTGAATCCCATTCTCTACGCCTTTCTTGATGAAAACTTCAAGCGGTGT TTCCGGGACTTCTGCTTTCCACTGAAGATGAGGATGGAGCGGCAGAGCACTAGCAGAGTC CGAAATACAGTTCAGGATCCTGCTTACCTGAGGGACATCGATGGGATGAATAAACCAGTA TGA
- Chromosome Location
- 8
- Locus
- 8q11.2
- External Identifiers
Resource Link UniProtKB ID P41145 UniProtKB Entry Name OPRK_HUMAN GenBank Protein ID 532060 GenBank Gene ID U11053 GenAtlas ID OPRK1 HGNC ID HGNC:8154 - General References
- Mansson E, Bare L, Yang D: Isolation of a human kappa opioid receptor cDNA from placenta. Biochem Biophys Res Commun. 1994 Aug 15;202(3):1431-7. [Article]
- Simonin F, Gaveriaux-Ruff C, Befort K, Matthes H, Lannes B, Micheletti G, Mattei MG, Charron G, Bloch B, Kieffer B: kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system. Proc Natl Acad Sci U S A. 1995 Jul 18;92(15):7006-10. [Article]
- Zhu J, Chen C, Xue JC, Kunapuli S, DeRiel JK, Liu-Chen LY: Cloning of a human kappa opioid receptor from the brain. Life Sci. 1995;56(9):PL201-7. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Wang JB, Johnson PS, Wu JM, Wang WF, Uhl GR: Human kappa opiate receptor second extracellular loop elevates dynorphin's affinity for human mu/kappa chimeras. J Biol Chem. 1994 Oct 21;269(42):25966-9. [Article]
- Li JG, Chen C, Liu-Chen LY: Ezrin-radixin-moesin-binding phosphoprotein-50/Na+/H+ exchanger regulatory factor (EBP50/NHERF) blocks U50,488H-induced down-regulation of the human kappa opioid receptor by enhancing its recycling rate. J Biol Chem. 2002 Jul 26;277(30):27545-52. Epub 2002 May 9. [Article]
- Chen C, Li JG, Chen Y, Huang P, Wang Y, Liu-Chen LY: GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J Biol Chem. 2006 Mar 24;281(12):7983-93. Epub 2006 Jan 23. [Article]
- Li JG, Chen C, Liu-Chen LY: N-Glycosylation of the human kappa opioid receptor enhances its stability but slows its trafficking along the biosynthesis pathway. Biochemistry. 2007 Sep 25;46(38):10960-70. Epub 2007 Aug 21. [Article]
- Wang YH, Sun JF, Tao YM, Chi ZQ, Liu JG: The role of kappa-opioid receptor activation in mediating antinociception and addiction. Acta Pharmacol Sin. 2010 Sep;31(9):1065-70. doi: 10.1038/aps.2010.138. Epub 2010 Aug 23. [Article]
- Bruchas MR, Chavkin C: Kinase cascades and ligand-directed signaling at the kappa opioid receptor. Psychopharmacology (Berl). 2010 Jun;210(2):137-47. doi: 10.1007/s00213-010-1806-y. Epub 2010 Apr 17. [Article]
- Wu H, Wacker D, Mileni M, Katritch V, Han GW, Vardy E, Liu W, Thompson AA, Huang XP, Carroll FI, Mascarella SW, Westkaemper RB, Mosier PD, Roth BL, Cherezov V, Stevens RC: Structure of the human kappa-opioid receptor in complex with JDTic. Nature. 2012 Mar 21;485(7398):327-32. doi: 10.1038/nature10939. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00454 Meperidine approved yes Details DB00611 Butorphanol approved, illicit, vet_approved yes agonist Details DB00844 Nalbuphine approved yes agonist Details DB00921 Buprenorphine approved, illicit, investigational, vet_approved yes antagonist Details DB00318 Codeine approved, illicit yes agonist Details DB00327 Hydromorphone approved, illicit yes agonist Details DB00647 Dextropropoxyphene approved, illicit, investigational, withdrawn yes antagonist Details DB01209 Dezocine approved, investigational yes antagonist Details DB00652 Pentazocine approved, vet_approved yes agonist Details DB00295 Morphine approved, investigational yes agonist Details DB00370 Mirtazapine approved unknown agonist Details DB00704 Naltrexone approved, investigational, vet_approved yes antagonist Details DB01571 3-Methylfentanyl illicit yes agonist Details DB01497 Etorphine illicit, vet_approved yes agonist Details DB05046 V1003 investigational unknown Details DB05104 Asimadoline investigational unknown Details DB05155 CR665 investigational unknown Details DB05443 ADL 10-0101 investigational unknown Details DB00497 Oxycodone approved, illicit, investigational yes agonist Details DB00193 Tramadol approved, investigational unknown agonist Details DB06204 Tapentadol approved unknown agonist Details DB06409 Morphine glucuronide investigational unknown Details DB01452 Diamorphine approved, illicit, investigational unknown agonist Details DB00708 Sufentanil approved, investigational unknown Details DB01535 Carfentanil illicit, investigational, vet_approved unknown agonist Details DB00321 Amitriptyline approved unknown agonist Details DB00854 Levorphanol approved unknown agonist Details DB01565 Dihydromorphine experimental, illicit unknown agonist Details DB01183 Naloxone approved, vet_approved yes antagonist Details DB00813 Fentanyl approved, illicit, investigational, vet_approved unknown agonist Details DB00825 Levomenthol approved unknown agonist Details DB01439 3-Methylthiofentanyl experimental, illicit yes agonist Details DB01548 Diprenorphine illicit, vet_approved unknown antagonist Details DB00836 Loperamide approved unknown agonist Details DB06274 Alvimopan approved, investigational unknown antagonist Details DB00899 Remifentanil approved unknown agonist Details DB06800 Methylnaltrexone approved no antagonist Details DB06738 Ketobemidone investigational yes agonist Details DB00514 Dextromethorphan approved unknown agonist Details DB00396 Progesterone approved, vet_approved unknown activatorpotentiator Details DB01221 Ketamine approved, vet_approved unknown agonist Details DB06148 Mianserin approved, investigational unknown agonist Details DB09272 Eluxadoline approved, investigational yes agonist Details DB06230 Nalmefene approved, investigational, withdrawn yes partial agonist Details DB11691 Naldemedine approved, investigational yes antagonist Details DB00555 Lamotrigine approved, investigational unknown inhibitor Details DB09209 Pholcodine approved, illicit yes antagonist Details DB11130 Opium approved, illicit yes agonist Details DB11186 Pentoxyverine approved, investigational, withdrawn unknown agonist Details DB14146 Loxicodegol investigational unknown agonist Details DB00289 Atomoxetine approved unknown partial agonist Details DB09173 Butyrfentanyl illicit unknown agonist Details DB01238 Aripiprazole approved, investigational unknown ligand Details DB06288 Amisulpride approved, investigational no agonist Details DB12543 Samidorphan approved, investigational unknown partial agonist Details DB11938 Difelikefalin approved, investigational yes agonist Details