Folate transporter 1

Details

Name
Folate transporter 1
Synonyms
  • FLOT1
  • FOLT
  • IFC-1
  • Intestinal folate carrier 1
  • Placental folate transporter
  • Reduced folate carrier protein
  • RFC
  • RFC1
  • Solute carrier family 19 member 1
Gene Name
SLC19A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008562|Folate transporter 1
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKA
AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPV
TTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
Number of residues
591
Molecular Weight
64867.62
Theoretical pI
Not Available
GO Classification
Functions
folic acid binding / folic acid transporter activity / methotrexate transporter activity / reduced folate carrier activity
Processes
folic acid metabolic process / folic acid transport / methotrexate transport / reduced folate transmembrane transport / small molecule metabolic process / transmembrane transport / vitamin metabolic process / water-soluble vitamin metabolic process
Components
apical plasma membrane / basolateral plasma membrane / integral component of plasma membrane / plasma membrane
General Function
Reduced folate carrier activity
Specific Function
Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump.
Pfam Domain Function
Transmembrane Regions
24-44 71-89 96-116 124-144 160-177 187-203 260-287 310-327 334-354 361-378 395-419 434-454
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0017517|Folate transporter 1 (SLC19A1)
ATGGTGCCCTCCAGCCCAGCGGTGGAGAAGCAGGTGCCCGTGGAACCTGGGCCTGACCCC
GAGCTCCGGTCCTGGCGGCACCTCGTGTGCTACCTTTGCTTCTACGGCTTCATGGCGCAG
ATACGGCCAGGGGAGAGCTTCATCACCCCCTACCTCCTGGGGCCCGACAAGAACTTCACG
CGGGAGCAGGTCACGAACGAGATCACGCCGGTGCTGTCGTACTCCTACCTGGCCGTGCTG
GTGCCCGTGTTCCTGCTCACCGACTACCTGCGCTACACGCCGGTGCTGCTGCTGCAGGGG
CTCAGCTTCGTGTCGGTGTGGCTGCTGCTGCTGCTGGGCCACTCGGTGGCGCACATGCAG
CTCATGGAGCTCTTCTACAGCGTCACCATGGCCGCGCGCATCGCCTATTCCTCCTACATC
TTCTCTCTCGTGCGGCCCGCGCGCTACCAGCGTGTGGCCGGCTACTCGCGCGCTGCGGTG
CTGCTGGGCGTGTTCACCAGCTCCGTGCTGGGCCAGCTGCTGGTCACTGTGGGCCGAGTC
TCCTTCTCCACGCTCAACTACATCTCGCTGGCCTTCCTCACCTTCAGCGTGGTCCTCGCC
CTCTTCCTGAAGCGCCCCAAGCGCAGCCTCTTCTTCAACCGCGACGACCGGGGGCGGTGC
GAAACCTCGGCTTCGGAGCTGGAGCGCATGAATCCTGGCCCAGGCGGGAAGCTGGGACAC
GCCCTGCGGGTGGCCTGTGGGGACTCAGTGCTGGCGCGGATGCTGCGGGAGCTGGGGGAC
AGCCTGCGGCGGCCGCAGCTGCGCCTGTGGTCCCTCTGGTGGGTCTTCAACTCGGCCGGC
TACTACCTGGTGGTCTACTACGTGCACATCCTGTGGAACGAGGTGGACCCCACCACCAAC
AGTGCGCGGGTCTACAACGGCGCGGCAGATGCTGCCTCCACGCTGCTGGGCGCCATCACG
TCCTTCGCCGCGGGCTTCGTGAAGATCCGCTGGGCGCGCTGGTCCAAGCTGCTCATCGCG
GGCGTCACGGCCACGCAGGCGGGGCTGGTCTTCCTTCTGGCGCACACGCGCCACCCGAGC
AGCATCTGGCTGTGCTATGCGGCCTTCGTGCTGTTCCGCGGCTCCTACCAGTTCCTCGTG
CCCATCGCCACCTTTCAGATTGCATCTTCTCTGTCTAAAGAGCTCTGTGCCCTGGTCTTC
GGGGTCAACACGTTCTTTGCCACCATCGTCAAGACCATCATCACTTTCATTGTCTCGGAC
GTGCGGGGCCTGGGCCTCCCGGTCCGCAAGCAGAATGAAGAACTGCATGTGGCTTCTCTG
TCTCTGTGGAAAAGCCATCTCAGGTTGGCGGCAGACACATTGTCATCAGAGGGGAGCAGC
GGCTCTGGTCCTCGGAGCTGGTTCCTCTCTCCCACCCTAAGGGCAGCCCTCCATGGTCCT
GTCTGTCCTTCTGAAGTGTGTCCATCCTGA
Chromosome Location
21
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP41440
UniProtKB Entry NameS19A1_HUMAN
HGNC IDHGNC:10937
General References
  1. Prasad PD, Ramamoorthy S, Leibach FH, Ganapathy V: Molecular cloning of the human placental folate transporter. Biochem Biophys Res Commun. 1995 Jan 17;206(2):681-7. [PubMed:7826387]
  2. Wong SC, Proefke SA, Bhushan A, Matherly LH: Isolation of human cDNAs that restore methotrexate sensitivity and reduced folate carrier activity in methotrexate transport-defective Chinese hamster ovary cells. J Biol Chem. 1995 Jul 21;270(29):17468-75. [PubMed:7615551]
  3. Moscow JA, Gong M, He R, Sgagias MK, Dixon KH, Anzick SL, Meltzer PS, Cowan KH: Isolation of a gene encoding a human reduced folate carrier (RFC1) and analysis of its expression in transport-deficient, methotrexate-resistant human breast cancer cells. Cancer Res. 1995 Sep 1;55(17):3790-4. [PubMed:7641195]
  4. Williams FM, Flintoff WF: Isolation of a human cDNA that complements a mutant hamster cell defective in methotrexate uptake. J Biol Chem. 1995 Feb 17;270(7):2987-92. [PubMed:7852378]
  5. Nguyen TT, Dyer DL, Dunning DD, Rubin SA, Grant KE, Said HM: Human intestinal folate transport: cloning, expression, and distribution of complementary RNA. Gastroenterology. 1997 Mar;112(3):783-91. [PubMed:9041240]
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  7. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Ferguson PL, Flintoff WF: Topological and functional analysis of the human reduced folate carrier by hemagglutinin epitope insertion. J Biol Chem. 1999 Jun 4;274(23):16269-78. [PubMed:10347183]
  10. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  11. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  12. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  13. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06813Pralatrexateapproved, investigationalunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB11256Levomefolic acidapproved, investigationalunknownsubstrateDetails
DB00507Nitazoxanideapproved, investigational, vet_approvedunknownDetails
DB01157Trimetrexateapproved, investigationalunknownsubstrateDetails