Metabotropic glutamate receptor 5

Details

Name
Metabotropic glutamate receptor 5
Synonyms
  • GPRC1E
  • MGLUR5
Gene Name
GRM5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002371|Metabotropic glutamate receptor 5
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
Number of residues
1212
Molecular Weight
132467.635
Theoretical pI
7.82
GO Classification
Functions
G-protein coupled receptor activity / glutamate receptor activity
Processes
activation of MAPKKK activity / cognition / desensitization of G-protein coupled receptor protein signaling pathway / G-protein coupled glutamate receptor signaling pathway / learning / locomotory behavior / negative regulation of locomotion / phospholipase C-activating G-protein coupled glutamate receptor signaling pathway / positive regulation of long-term neuronal synaptic plasticity / protein kinase C-activating G-protein coupled receptor signaling pathway / protein phosphorylation / regulation of synaptic transmission, glutamatergic / regulation of transcription, DNA-templated / synaptic transmission
Components
astrocyte projection / cytoplasm / dendritic shaft / dendritic spine / extracellular exosome / integral component of plasma membrane / plasma membrane / postsynaptic density
General Function
Glutamate receptor activity
Specific Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
Pfam Domain Function
Transmembrane Regions
581-603 614-636 645-667 694-714 738-759 773-795 799-820
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010830|Metabotropic glutamate receptor 5 (GRM5)
ATGGTCCTTCTGTTGATCCTGTCAGTCTTACTTTTGAAAGAAGATGTCCGTGGGAGTGCA
CAGTCCAGTGAGAGGAGGGTGGTGGCTCACATGCCGGGTGACATCATTATTGGAGCTCTC
TTTTCTGTTCATCACCAGCCTACTGTGGACAAAGTTCATGAGAGGAAGTGTGGGGCGGTC
CGTGAACAGTATGGCATTCAGAGAGTGGAGGCCATGCTGCATACCCTGGAAAGGATCAAT
TCAGACCCCACACTCTTGCCCAACATCACACTGGGCTGTGAGATAAGGGACTCCTGCTGG
CATTCGGCTGTGGCCCTAGAGCAGAGCATTGAGTTCATAAGAGATTCCCTCATTTCTTCA
GAAGAGGAAGAAGGCTTGGTACGCTGTGTGGATGGCTCCTCCTCTTCCTTCCGCTCCAAG
AAGCCCATAGTAGGGGTCATTGGGCCTGGCTCCAGTTCTGTAGCCATTCAGGTCCAGAAT
TTGCTCCAGCTTTTCAACATACCTCAGATTGCTTACTCAGCAACCAGCATGGATCTGAGT
GACAAGACTCTGTTCAAATATTTCATGAGGGTTGTGCCTTCAGATGCTCAGCAGGCAAGG
GCCATGGTGGACATAGTGAAGAGGTACAACTGGACCTATGTATCAGCCGTGCACACAGAA
GGCAACTATGGAGAAAGTGGGATGGAAGCCTTCAAAGATATGTCAGCGAAGGAAGGGATT
TGCATCGCCCACTCTTACAAAATCTACAGTAATGCAGGGGAGCAGAGCTTTGATAAGCTG
CTGAAGAAGCTCACAAGTCACTTGCCCAAGGCCCGGGTGGTGGCCTGCTTCTGTGAGGGC
ATGACGGTGAGAGGTCTGCTGATGGCCATGAGGCGCCTGGGTCTAGCGGGAGAATTTCTG
CTTCTGGGCAGTGATGGCTGGGCTGACAGGTATGATGTGACAGATGGATATCAGCGAGAA
GCTGTTGGTGGCATCACAATCAAGCTCCAATCTCCCGATGTCAAGTGGTTTGATGATTAT
TATCTGAAGCTCCGGCCAGAAACAAACCACCGAAACCCTTGGTTTCAAGAATTTTGGCAG
CATCGTTTTCAGTGCCGACTGGAAGGGTTTCCACAGGAGAACAGCAAATACAACAAGACT
TGCAATAGTTCTCTGACTCTGAAAACACATCATGTTCAGGATTCCAAAATGGGATTTGTG
ATCAACGCCATCTATTCGATGGCCTATGGGCTCCACAACATGCAGATGTCCCTCTGCCCA
GGCTATGCAGGACTCTGTGATGCCATGAAGCCAATTGATGGACGGAAACTTTTGGAGTCC
CTGATGAAAACCAATTTTACTGGGGTTTCTGGAGATACGATCCTATTCGATGAGAATGGA
GACTCTCCAGGAAGGTATGAAATAATGAATTTCAAGGAAATGGGAAAAGATTACTTTGAT
TATATCAACGTTGGAAGTTGGGACAATGGAGAATTAAAAATGGATGATGATGAAGTATGG
TCCAAGAAAAGCAACATCATCAGATCTGTGTGCAGTGAACCATGTGAGAAAGGCCAGATC
AAGGTGATCCGAAAGGGAGAAGTCAGCTGTTGTTGGACCTGTACACCTTGTAAGGAGAAT
GAGTATGTCTTTGATGAGTACACATGCAAGGCATGCCAACTGGGGTCTTGGCCCACTGAT
GATCTCACAGGTTGTGACTTGATCCCAGTACAGTATCTTCGATGGGGTGACCCTGAACCC
ATTGCAGCTGTGGTGTTTGCCTGCCTTGGCCTCCTGGCCACCCTGTTTGTTACTGTAGTC
TTCATCATTTACCGTGATACACCAGTAGTCAAGTCCTCAAGCAGGGAACTCTGCTACATT
ATCCTTGCTGGCATCTGCCTGGGCTACTTATGTACCTTCTGCCTCATTGCGAAGCCCAAA
CAGATTTACTGCTACCTTCAGAGAATTGGCATTGGTCTCTCCCCAGCCATGAGCTACTCA
GCCCTTGTAACAAAGACCAACCGTATTGCAAGGATCCTGGCTGGCAGCAAGAAGAAGATC
TGTACCAAAAAGCCCAGATTCATGAGTGCCTGTGCCCAGCTAGTGATTGCTTTCATTCTC
ATATGCATCCAGTTGGGCATCATCGTTGCCCTCTTTATAATGGAGCCTCCTGACATAATG
CATGACTACCCAAGCATTCGAGAAGTCTACCTGATCTGTAACACCACCAACCTAGGAGTT
GTCACTCCACTTGGATACAATGGATTGTTGATTTTGAGCTGCACCTTCTATGCGTTCAAG
ACCAGAAATGTTCCAGCTAACTTCAACGAGGCCAAGTATATCGCCTTCACAATGTACACG
ACCTGCATTATATGGCTAGCTTTTGTGCCAATCTACTTTGGCAGCAACTACAAAATCATC
ACCATGTGTTTCTCGGTCAGCCTCAGTGCCACAGTGGCCCTAGGCTGCATGTTTGTGCCG
AAGGTGTACATCATCCTGGCCAAACCAGAGAGAAACGTGCGCAGCGCCTTCACCACATCT
ACCGTGGTGCGCATGCATGTAGGGGATGGCAAGTCATCCTCCGCAGCCAGCAGATCCAGC
AGCCTAGTCAACCTGTGGAAGAGAAGGGGCTCCTCTGGGGAAACCTTAAGTTCCAATGGA
AAATCCGTCACGTGGGCCCAGAATGAGAAGAGCAGCCGGGGGCAGCACCTGTGGCAGCGC
CTGTCCATCCACATCAACAAGAAAGAAAACCCCAACCAAACGGCCGTCATCAAGCCCTTC
CCCAAGAGCACGGAGAGCCGTGGCCTGGGCGCTGGCGCTGGCGCAGGCGGGAGCGCTGGG
GGCGTGGGGGCCACGGGCGGTGCGGGCTGCGCAGGCGCCGGCCCAGGCGGGCCCGAGTCC
CCAGACGCCGGCCCCAAGGCGCTGTATGATGTGGCCGAGGCTGAGGAGCACTTCCCGGCG
CCCGCGCGGCCGCGCTCACCGTCGCCCATCAGCACGCTGAGCCACCGCGCGGGCTCGGCC
AGCCGCACGGACGACGATGTGCCGTCGCTGCACTCGGAGCCTGTGGCGCGCAGCAGCTCC
TCGCAGGGCTCCCTCATGGAGCAGATCAGCAGTGTGGTCACCCGCTTCACGGCCAACATC
AGCGAGCTCAACTCCATGATGCTGTCCACCGCGGCCCCCAGCCCCGGCGTCGGCGCCCCG
CTCTGCTCGTCCTACCTGATCCCCAAAGAGATCCAGTTGCCCACGACCATGACGACCTTT
GCCGAAATCCAGCCTCTGCCGGCCATCGAAGTCACGGGAGGCGCGCAGCCCGCGGCAGGG
GCGCAGGCGGCTGGGGACGCGGCCCGGGAGAGCCCCGCGGCCGGTCCCGAGGCTGCGGCC
GCCAAGCCAGACCTGGAGGAGCTGGTGGCTCTCACCCCGCCGTCCCCCTTCAGAGACTCG
GTGGACTCGGGGAGCACAACCCCCAACTCGCCAGTGTCCGAGTCGGCCCTCTGTATCCCG
TCGTCTCCCAAATATGACACTCTTATCATAAGAGATTACACTCAGAGCTCCTCGTCGTTG
TGA
Chromosome Location
11
Locus
11q14.2-q14.3
External Identifiers
ResourceLink
UniProtKB IDP41594
UniProtKB Entry NameGRM5_HUMAN
GenBank Protein ID1408052
GenBank Gene IDD28538
GenAtlas IDGRM5
HGNC IDHGNC:4597
General References
  1. Minakami R, Katsuki F, Yamamoto T, Nakamura K, Sugiyama H: Molecular cloning and the functional expression of two isoforms of human metabotropic glutamate receptor subtype 5. Biochem Biophys Res Commun. 1994 Mar 30;199(3):1136-43. [PubMed:7908515]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  3. Minakami R, Katsuki F, Sugiyama H: A variant of metabotropic glutamate receptor subtype 5: an evolutionally conserved insertion with no termination codon. Biochem Biophys Res Commun. 1993 Jul 30;194(2):622-7. [PubMed:7688218]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00659Acamprosateapproved, investigationalyesantagonistDetails
DB05070ADX10059investigationalunknownDetails
DB12733DipraglurantinvestigationalunknownDetails
DB06201RufinamideapprovedunknowninhibitorDetails