Glutamate receptor 3

Details

Name
Glutamate receptor 3
Synonyms
  • AMPA-selective glutamate receptor 3
  • GluA3
  • GluR-3
  • GluR-C
  • GluR-K3
  • GLUR3
  • GLURC
  • Glutamate receptor ionotropic, AMPA 3
Gene Name
GRIA3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001658|Glutamate receptor 3
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Number of residues
894
Molecular Weight
101155.975
Theoretical pI
8.74
GO Classification
Functions
AMPA glutamate receptor activity / extracellular-glutamate-gated ion channel activity
Processes
glutamate receptor signaling pathway / ion transmembrane transport / ionotropic glutamate receptor signaling pathway / synaptic transmission / synaptic transmission, glutamatergic / transport
Components
AMPA glutamate receptor complex / cell junction / dendrite / endocytic vesicle membrane / nucleoplasm / plasma membrane / postsynaptic membrane
General Function
Extracellular-glutamate-gated ion channel activity
Specific Function
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
Pfam Domain Function
Transmembrane Regions
553-573 628-648 824-844
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010586|Glutamate receptor 3 (GRIA3)
ATGGCCAGGCAGAAGAAAATGGGGCAAAGCGTGCTCCGGGCGGTCTTCTTTTTAGTCCTG
GGGCTTTTGGGTCATTCTCACGGAGGATTCCCCAACACCATCAGCATAGGTGGACTTTTC
ATGAGAAACACAGTGCAGGAGCACAGCGCTTTCCGCTTTGCCGTGCAGTTATACAACACC
AACCAGAACACCACCGAGAAGCCCTTCCATTTGAATTACCACGTAGATCACTTGGATTCC
TCCAATAGTTTTTCCGTGACAAATGCTTTCTGCTCCCAGTTCTCGAGAGGGGTGTATGCC
ATCTTTGGATTCTATGACCAGATGTCAATGAACACCCTGACCTCCTTCTGTGGGGCCCTG
CACACATCCTTTGTTACGCCTAGCTTCCCCACTGACGCAGATGTGCAGTTTGTCATCCAG
ATGCGCCCAGCCTTGAAGGGCGCTATTCTGAGTCTTCTGGGTCATTACAAGTGGGAGAAG
TTTGTGTACCTCTATGACACAGAACGAGGATTTTCCATCCTCCAAGCGATTATGGAAGCA
GCAGTGCAAAACAACTGGCAAGTAACAGCAAGGTCTGTGGGAAACATAAAGGACGTCCAA
GAATTCAGGCGCATCATTGAAGAAATGGACAGGAGGCAGGAAAAGCGATACTTGATTGAC
TGCGAAGTCGAAAGGATTAACACAATTTTGGAACAGGTTGTGATCCTAGGGAAACACTCA
AGAGGTTATCACTACATGCTCGCTAACCTGGGTTTTACTGATATTTTACTGGAAAGAGTC
ATGCATGGGGGAGCCAACATTACAGGTTTCCAGATTGTCAACAATGAAAACCCTATGGTT
CAGCAGTTCATACAGCGCTGGGTGAGGCTGGATGAAAGGGAATTCCCTGAAGCCAAGAAT
GCACCACTAAAGTATACATCTGCATTGACACACGACGCAATACTGGTCATAGCAGAAGCT
TTCCGCTACCTGAGGAGGCAGCGAGTAGATGTGTCCCGGAGAGGAAGTGCTGGAGACTGC
TTAGCAAATCCTGCTGTGCCCTGGAGTCAAGGAATTGATATTGAGAGAGCTCTGAAAATG
GTGCAAGTACAAGGAATGACTGGAAATATTCAATTTGACACTTATGGACGTAGGACAAAT
TATACCATCGATGTGTATGAAATGAAAGTCAGTGGCTCTCGAAAAGCTGGCTACTGGAAT
GAGTATGAAAGGTTTGTGCCTTTCTCAGATCAGCAAATCAGCAATGACAGTGCATCCTCA
GAGAATCGGACCATAGTAGTGACTACCATTCTGGAATCACCATATGTAATGTACAAGAAG
AACCATGAGCAACTGGAAGGAAATGAACGATATGAAGGCTATTGTGTAGACCTAGCCTAT
GAAATAGCCAAACATGTAAGGATCAAATACAAATTGTCCATCGTTGGTGACGGGAAATAT
GGTGCAAGGGATCCAGAGACTAAAATATGGAACGGCATGGTTGGGGAACTTGTCTATGGG
AGAGCTGATATAGCTGTTGCTCCACTCACTATAACATTGGTCCGTGAAGAAGTCATAGAT
TTTTCAAAGCCATTCATGAGCCTGGGCATCTCCATCATGATAAAGAAGCCTCAGAAATCA
AAACCAGGCGTATTCTCATTTCTGGATCCCCTGGCTTATGAAATCTGGATGTGCATTGTC
TTTGCTTACATTGGAGTCAGCGTAGTTCTTTTCCTAGTCAGCAGGTTCAGTCCTTATGAA
TGGCACTTGGAAGACAACAATGAAGAACCTCGTGACCCACAAAGTCCTCCTGATCCTCCA
AATGAATTTGGAATATTTAACAGTCTTTGGTTTTCCTTGGGTGCCTTTATGCAGCAAGGA
TGTGATATTTCTCCAAGATCACTCTCCGGGCGCATTGTTGGAGGGGTTTGGTGGTTCTTC
ACCCTGATCATAATTTCTTCCTATACTGCCAATCTCGCTGCTTTCCTGACTGTGGAGAGG
ATGGTTTCTCCCATAGAGAGTGCTGAAGACTTAGCTAAACAGACTGAAATTGCATATGGG
ACCCTGGACTCCGGTTCAACAAAAGAATTTTTCAGAAGATCCAAAATTGCTGTGTACGAG
AAAATGTGGTCTTACATGAAATCAGCGGAGCCATCTGTGTTTACCAAAACAACAGCAGAC
GGAGTGGCCCGAGTGCGAAAGTCCAAGGGAAAGTTCGCCTTCCTGCTGGAGTCAACCATG
AATGAGTACATTGAGCAGAGAAAACCATGTGATACGATGAAAGTTGGTGGAAATCTGGAT
TCCAAAGGCTATGGTGTGGCAACCCCTAAAGGCTCAGCATTAGGAAATGCTGTTAACCTG
GCAGTATTAAAACTGAATGAGCAAGGCCTCTTGGACAAATTGAAAAACAAATGGTGGTAC
GACAAAGGAGAGTGCGGCAGCGGGGGCGGTGACTCCAAGGACAAGACCAGCGCTCTGAGC
CTGAGCAATGTGGCAGGCGTTTTCTATATACTTGTCGGAGGTCTGGGGCTGGCCATGATG
GTGGCTTTGATAGAATTCTGTTACAAATCACGGGCAGAGTCCAAACGCATGAAACTCACA
AAGAACACCCAAAACTTTAAGCCTGCTCCTGCCACCAACACTCAGAATTATGCTACATAC
AGAGAAGGCTACAACGTGTATGGAACAGAGAGTGTTAAGATCTAG
Chromosome Location
X
Locus
Xq25-q26
External Identifiers
ResourceLink
UniProtKB IDP42263
UniProtKB Entry NameGRIA3_HUMAN
GenBank Protein ID507829
GenBank Gene IDU10302
GenAtlas IDGRIA3
HGNC IDHGNC:4573
General References
  1. Rampersad V, Elliott CE, Nutt SL, Foldes RL, Kamboj RK: Human glutamate receptor hGluR3 flip and flop isoforms: cloning and sequencing of the cDNAs and primary structure of the proteins. Biochim Biophys Acta. 1994 Oct 18;1219(2):563-6. [PubMed:7918660]
  2. Gecz J, Barnett S, Liu J, Hollway G, Donnelly A, Eyre H, Eshkevari HS, Baltazar R, Grunn A, Nagaraja R, Gilliam C, Peltonen L, Sutherland GR, Baron M, Mulley JC: Characterization of the human glutamate receptor subunit 3 gene (GRIA3), a candidate for bipolar disorder and nonspecific X-linked mental retardation. Genomics. 1999 Dec 15;62(3):356-68. [PubMed:10644433]
  3. Amir R, Dahle EJ, Toriolo D, Zoghbi HY: Candidate gene analysis in Rett syndrome and the identification of 21 SNPs in Xq. Am J Med Genet. 2000 Jan 3;90(1):69-71. [PubMed:10602120]
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651]
  5. Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. [PubMed:21172611]
  6. Wu Y, Arai AC, Rumbaugh G, Srivastava AK, Turner G, Hayashi T, Suzuki E, Jiang Y, Zhang L, Rodriguez J, Boyle J, Tarpey P, Raymond FL, Nevelsteen J, Froyen G, Stratton M, Futreal A, Gecz J, Stevenson R, Schwartz CE, Valle D, Huganir RL, Wang T: Mutations in ionotropic AMPA receptor 3 alter channel properties and are associated with moderate cognitive impairment in humans. Proc Natl Acad Sci U S A. 2007 Nov 13;104(46):18163-8. Epub 2007 Nov 7. [PubMed:17989220]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00142Glutamic acidapproved, nutraceuticalunknownDetails
DB04982TalampanelinvestigationalunknownDetails
DB05047CX717illicit, investigationalunknownDetails
DB04599AniracetamexperimentalunknownDetails
DB01356Lithium cationexperimentalunknownpotentiatorDetails
DB00898EthanolapprovedunknownDetails
DB13146Fluciclovine (18F)approvednoinhibitorDetails
DB14507Lithium citrateapprovedunknownDetails
DB14508Lithium succinateexperimentalunknownDetails
DB14509Lithium carbonateapprovedunknownDetails