Ornithine decarboxylase, inducible

Details

Name
Ornithine decarboxylase, inducible
Synonyms
  • 4.1.1.17
  • ODC
Gene Name
odcI
Organism
Lactobacillus sp. (strain 30a)
Amino acid sequence
>lcl|BSEQ0019177|Ornithine decarboxylase, inducible
MSSSLKIASTQEARQYFDTDRVVVDAVGSDFTDVGAVIAMDYETDVIDAADATKFGIPVF
AVTKDAQAISADELKKIFHIIDLENKFDATVNAREIETAVNNYEDSILPPFFKSLKEYVS
RGLIQFDCPGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLIHEGPAVAAE
KHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALAMAGGRPV
YLQTNRNPYGFIGGIYDSDFDEKKIRELAAKVDPERAKWKRPFRLAVIQLGTYDGTIYNA
HEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRNSSPLLIDDLGPEDPGIIVVQSVHKQQAG
FSQTSQIHKKDSHIKGQLRYCDHKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRK
LWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWH
AYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKSDLNSI
LFLMTPAETPAKMNNLITQLLQLQRLIEEDAPLKQVLPSIYAANEERYNGYTIRELCQEL
HDFYKNNNTFTYQKRLFLREFFPEQGMLPYEARQEFIRNHNKLVPLNKIEGEIALEGALP
YPPGVFCVAPGEKWSETAVKYFTILQDGINNFPGFAPEIQGVYFKQEGDKVVAYGEVYDA
EVAKNDDRYNN
Number of residues
731
Molecular Weight
82687.46
Theoretical pI
4.99
GO Classification
Functions
ornithine decarboxylase activity
Processes
cellular amino acid metabolic process
Components
cytoplasm
General Function
Ornithine decarboxylase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0003495|2196 bp
ATGAGTTCTTCTCTTAAAATTGCTTCGACTCAAGAAGCGCGTCAATATTTCGATACTGAC
CGCGTTGTTGTCGATGCTGTAGGCTCTGATTTTACTGATGTCGGTGCTGTTATCGCAATG
GATTACGAAACAGATGTCATCGACGCTGCTGATGCAACTAAGTTTGGTATTCCTGTTTTT
GCCGTAACTAAGGATGCCCAAGCTATCAGTGCTGATGAGCTGAAGAAGATTTTCCACATC
ATTGATTTGGAAAACAAATTTGATGCTACTGTTAACGCTCGTGAAATCGAAACTGCTGTT
AACAACTACGAAGACAGCATTTTACCACCATTCTTCAAGTCATTGAAAGAATACGTTAGC
CGTGGTTTAATCCAATTCGACTGCCCAGGTCACCAAGGTGGTCAATACTACAGAAAGCAC
CCAGCTGGTCGTGAATTCTACGACTTCTTCGGCGAAACTGTCTTCCGTGCAGACTTATGT
AACGCTGACGTTGCCTTGGGTGACTTGCTGATCCACGAAGGTCCTGCTGTTGCTGCTGAA
AAGCATGCTGCACGTGTTTACAACGCTGACAAGACTTACTTCGTTTTAGGTGGTTCTTCC
AACGCTAACAACACTGTAACATCTGCTTTAGTTTCTAACGGCGACTTGGTATTGTTCGAC
CGGAACAACCACAAGTCCGTTTACAACTCAGCTTTAGCTATGGCTGGTGGCCGTCCTGTT
TACCTCCAAACAAACCGTAACCCATACGGCTTCATCGGTGGTATCTACGACAGCGACTTC
GATGAAAAGAAGATCCGTGAACTGGCAGCTAAGGTTGACCCAGAACGTGCTAAGTGGAAG
CGTCCATTCCGTCTGGCTGTTATCCAATTAGGTACTTACGATGGTACTATCTACAACGCA
CACGAAGTTGTAAAGCGTATCGGTCACCTTTGTGATTACATCGAATTCGACTCTGCTTGG
GTAGGTTACGAACAATTCATTCCTATGATGCGTAACTCTTCACCATTATTGATTGATGAC
CTTGGTCCAGAAGATCCTGGTATCATTGTTGTTCAATCAGTTCACAAGCAACAAGCCGGC
TTCTCACAAACTTCACAAATCCACAAGAAGGATAGCCACATCAAGGGTCAATTACGTTAC
TGTGACCACAAGCACTTTAACAACTCCTTCAACTTGTTCATGTCTACTTCACCATTCTAC
CCAATGTATGCAGCATTAGACGTTAACGCTGCTATGCAAGAAGGCGAAGCAGGTCGCAAG
TTATGGCATGACCTTCTGATTACTACCATTGAAGCTCGTAAGAAGTTGATCAAGGCTGGC
TCAATGTTCCGTCCATTCGTTCCACCTGTTGTTAACGGCAAGAAGTGGGAAGATGGCGAC
ACTGAAGATATGGCTAACAACATTGACTACTGGCGCTTTGAAAAGGGTGCTAAGTGGCAT
GCTTACGAAGGCTACGGCGACAACCAATACTACGTTGATCCAAACAAGTTCATGTTAACT
ACACCTGGTATCAACCCAGAAACTGGTGACTACGAAGACTTCGGTGTTCCAGCTACTATC
GTTGCTAACTACTTACGTGACCACGGTATCATCCCTGAAAAGTCTGACTTGAACTCTATC
TTGTTCTTGATGACTCCAGCTGAAACTCCAGCTAAGATGAACAACCTGATCACTCAACTT
CTTCAATTACAACGCTTGATCGAAGAAGATGCTCCATTGAAGCAAGTTCTTCCTTCAATC
TACGCTGCTAACGAAGAACGTTACAATGGCTACACTATCCGTGAACTTTGCCAAGAATTG
CACGACTTCTACAAGAACAACAACACGTTCACATACCAGAAGCGTCTCTTCTTACGTGAA
TTCTTCCCAGAACAAGGTATGCTTCCATACGAAGCTCGTCAAGAATTCATCCGCAACCAC
AACAAGCTTGTTCCATTGAACAAGATCGAAGGCGAAATCGCCCTCGAAGGTGCTCTTCCA
TACCCTCCAGGAGTATTCTGTGTAGCACCAGGTGAAAAGTGGTCAGAAACTGCTGTTAAG
TACTTCACTATCTTACAAGATGGTATCAACAACTTCCCTGGATTCGCTCCAGAAATCCAA
GGTGTATACTTCAAGCAAGAAGGCGACAAGGTTGTTGCTTACGGTGAAGTTTACGATGCA
GAAGTTGCTAAGAACGATGATCGTTACAACAACTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP43099
UniProtKB Entry NameDCOR_LACS3
GenBank Protein ID555803
GenBank Gene IDU11816
General References
  1. Hackert ML, Carroll DW, Davidson L, Kim SO, Momany C, Vaaler GL, Zhang L: Sequence of ornithine decarboxylase from Lactobacillus sp. strain 30a. J Bacteriol. 1994 Dec;176(23):7391-4. [PubMed:7961515]
  2. Momany C, Ernst S, Ghosh R, Chang NL, Hackert ML: Crystallographic structure of a PLP-dependent ornithine decarboxylase from Lactobacillus 30a to 3.0 A resolution. J Mol Biol. 1995 Oct 6;252(5):643-55. [PubMed:7563080]
  3. Vitali J, Carroll D, Chaudhry RG, Hackert ML: Three-dimensional structure of the Gly121Tyr dimeric form of ornithine decarboxylase from Lactobacillus 30a. Acta Crystallogr D Biol Crystallogr. 1999 Dec;55(Pt 12):1978-85. [PubMed:10666573]
  4. Momany C, Ghosh R, Hackert ML: Structural motifs for pyridoxal-5'-phosphate binding in decarboxylases: an analysis based on the crystal structure of the Lactobacillus 30a ornithine decarboxylase. Protein Sci. 1995 May;4(5):849-54. [PubMed:7663340]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04137Guanosine-5'-TriphosphateexperimentalunknownDetails