DNA gyrase subunit A

Details

Name
DNA gyrase subunit A
Synonyms
  • 5.99.1.3
Gene Name
gyrA
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Amino acid sequence
>lcl|BSEQ0010114|DNA gyrase subunit A
MTDSIQSSITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFSMDREGNTA
NKKYVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDAPAA
MRYTEVRMQKITQALLTDLDKETVNFSPNYDGELMIPDVLPTRIPALLANGSSGIAVGMA
TNIPPHNLNEVLNGCLAYIDKNEITIDELMQHIPGPDFPTAALINGRKGIEEAYRTGRGK
VYVRARATVETNEKGREQIIVSELPYQVNKAKLVEKIAELIREKKIEGISNITDLSNKEG
IRIEIDIKRDAVGEVVLNHLYSLTQMQVTFGINMVALDHGQPRLFNLKEIIEAFVLHRRE
VVTRRSIFELRKARERTHILEGLAVARSNIDEMIAIIRNSKNREEAATSISSRSWTLHSD
IINLLDASARPDELEENLGIQGEQYYLSPAQVNAILELRLHRLTGIAFEEVIKEYEELLV
KIADLLHILSSAERLMEVIREELEEVKAQFGDDRLTEITAASGDIDLEDLIAQEDVVVTL
SHEGYVKYQPLTDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYWLK
VYQLPQASRGARGRPIVNILPLQENERITAILPVSAYEEDKFVVMATAGGIVKKIALTEF
SRPRSNGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFAENAVRAMGRLATGVRG
IKLALTNDISDDESAVEIEDISDDNAEASLDLNIDKVVSLVVPKGEGAILTATQNGYGKR
TQLSEYPTKSRNTKGVISIKVSERNGKVVAATQVEETDQIMLITDAGTLVRTRVSEVSIV
GRNTQGVRLIRTADDEHVVSLERVCDADEDDSLEESSSEE
Number of residues
880
Molecular Weight
97817.145
Theoretical pI
4.85
GO Classification
Functions
ATP binding / DNA binding / DNA topoisomerase type II (ATP-hydrolyzing) activity
Processes
DNA topological change / DNA-dependent DNA replication
Components
chromosome / cytoplasm
General Function
Dna topoisomerase type ii (atp-hydrolyzing) activity
Specific Function
DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of double-stranded DNA rings, including catenanes and knotted rings.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010115|DNA gyrase subunit A (gyrA)
ATGACGGATTCAATCCAATCATCTATCACCCCTGTCAATATCGAAGAAGAACTTAAATCT
TCCTACCTTGACTACGCGATGTCGGTTATCGTTGGGCGTGCATTACCTGACGTTCGAGAT
GGTTTAAAACCTGTTCACCGCCGCGTACTATTCTCAATGGATCGCGAAGGCAATACCGCC
AATAAAAAATACGTAAAATCAGCGCGTGTTGTGGGTGATGTAATCGGTAAATATCACCCG
CATGGTGACTCCGCCGTGTACGATACCATCGTTCGTATGGCACAACCCTTCTCACTTCGC
TATATGTTGGTTGATGGGCAAGGTAACTTTGGTTCAATTGATGGTGATGCGCCAGCTGCA
ATGCGTTATACCGAAGTACGTATGCAAAAAATTACGCAAGCATTGCTCACGGATTTGGAT
AAAGAAACCGTCAATTTCTCGCCAAACTATGATGGCGAATTAATGATTCCAGATGTATTG
CCGACTCGTATTCCAGCACTGTTAGCAAATGGTTCTTCTGGTATTGCGGTGGGGATGGCA
ACTAACATTCCCCCTCACAACTTAAACGAAGTATTAAATGGTTGTTTGGCTTATATTGAC
AAAAATGAAATTACCATTGATGAATTAATGCAACATATTCCAGGGCCTGACTTCCCAACG
GCTGCGTTAATTAATGGTCGTAAAGGGATTGAAGAGGCCTATCGCACTGGTCGTGGTAAA
GTGTATGTTCGTGCTCGTGCAACGGTAGAAACCAACGAAAAAGGACGCGAGCAAATTATC
GTGTCTGAATTGCCATACCAAGTAAATAAAGCAAAATTAGTCGAGAAAATCGCCGAATTA
ATTCGCGAGAAAAAAATCGAAGGTATCAGCAATATTACTGACCTTTCAAATAAAGAAGGG
ATCCGTATTGAAATTGATATTAAACGTGATGCAGTGGGGGAAGTGGTATTAAACCATCTT
TACTCACTCACTCAAATGCAAGTGACCTTTGGTATCAATATGGTGGCATTGGATCACGGT
CAGCCACGTTTATTTAATCTTAAAGAAATTATTGAAGCCTTTGTTTTACACCGCCGTGAA
GTGGTTACACGTCGTTCTATCTTTGAGCTTCGCAAAGCACGTGAACGTACGCATATTTTG
GAAGGTTTAGCGGTTGCTCGTTCTAATATCGATGAAATGATTGCGATCATTCGTAACTCT
AAAAACCGTGAAGAAGCCGCAACATCAATCAGTTCACGCTCTTGGACGTTACATAGCGAT
ATTATTAATCTTCTTGATGCTTCTGCTCGTCCTGATGAGTTAGAAGAAAATCTTGGTATT
CAAGGCGAACAATATTACTTATCGCCAGCGCAAGTAAACGCAATTCTAGAACTTCGCTTA
CACCGTTTAACGGGCATTGCGTTTGAAGAAGTTATAAAAGAATATGAAGAATTATTAGTT
AAAATTGCGGATCTTCTTCATATTTTAAGTAGTGCAGAACGTTTAATGGAAGTAATTCGT
GAAGAATTGGAAGAAGTAAAAGCACAATTTGGTGATGATCGTTTAACTGAAATTACCGCT
GCTTCTGGCGATATTGATTTAGAAGATTTAATCGCACAAGAAGACGTGGTTGTGACGCTT
TCTCACGAAGGTTATGTGAAATACCAACCACTGACTGACTATGAAGCACAACGCCGTGGC
GGTAAAGGCAAATCTGCAACGAAGATGAAAGAAGAAGATTTCATCGAAAAATTACTGGTA
GCAAATACTCACGATACCATCCTCTGCTTCTCTAGCCGTGGTCGTTTATATTGGTTGAAA
GTATATCAACTTCCGCAAGCGAGCCGTGGCGCACGCGGTCGTCCAATTGTGAATATTCTT
CCGTTACAAGAAAACGAACGTATTACTGCAATCTTGCCAGTTTCTGCTTACGAAGAAGAT
AAATTCGTAGTCATGGCAACTGCTGGCGGTATTGTGAAGAAAATCGCCTTAACCGAATTT
AGCCGTCCACGTTCAAACGGTATCATCGCATTGAATTTACGTGACGAAGATGAATTAATC
GGCGTGGATATTACTGATGGCAGCAACGAAATTATGTTGTTCTCATCACAAGGTCGCGTG
GTGCGTTTTGCTGAAAATGCCGTGCGTGCGATGGGGCGTTTAGCAACAGGTGTTCGCGGT
ATCAAACTGGCTTTAACAAACGATATTTCTGACGATGAAAGTGCGGTAGAAATTGAAGAT
ATTTCTGATGACAACGCTGAAGCATCATTAGACTTAAATATCGATAAAGTGGTCTCGCTC
GTTGTGCCAAAAGGTGAAGGGGCAATTTTAACCGCAACGCAAAACGGCTACGGAAAACGC
ACACAATTAAGTGAATACCCAACTAAATCACGTAATACAAAAGGTGTGATTTCGATTAAA
GTGAGTGAACGCAATGGTAAAGTCGTTGCCGCAACTCAAGTAGAAGAAACAGACCAAATT
ATGTTGATCACTGATGCAGGAACCCTTGTTCGCACACGCGTAAGCGAAGTGAGCATTGTA
GGGCGTAACACGCAAGGTGTTCGCTTAATTCGTACTGCCGATGATGAACACGTAGTAAGT
TTAGAACGTGTTTGTGATGCAGATGAAGATGATTCTTTGGAAGAAAGCAGTTCTGAAGAA
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP43700
UniProtKB Entry NameGYRA_HAEIN
GenBank Protein ID1574722
GenBank Gene IDL42023
General References
  1. Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA, Merrick JM, et al.: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science. 1995 Jul 28;269(5223):496-512. [PubMed:7542800]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00218Moxifloxacinapproved, investigationalyesinhibitorDetails
DB00365Grepafloxacinapproved, investigational, withdrawnyesinhibitorDetails
DB00467Enoxacinapproved, investigationalyesinhibitorDetails
DB00487PefloxacinapprovedyesinhibitorDetails
DB00537Ciprofloxacinapproved, investigationalyesinhibitorDetails
DB00685Trovafloxacinapproved, investigational, withdrawnyesinhibitorDetails
DB00978Lomefloxacinapproved, investigationalyesinhibitorDetails
DB01059NorfloxacinapprovedyesinhibitorDetails
DB01137Levofloxacinapproved, investigationalyesinhibitorDetails
DB01155Gemifloxacinapproved, investigationalyesinhibitorDetails
DB01165OfloxacinapprovedyesinhibitorDetails
DB01208Sparfloxacinapproved, investigational, withdrawnyesinhibitorDetails
DB01405TemafloxacinwithdrawnyesinhibitorDetails
DB00827Cinoxacinapproved, investigational, withdrawnyesinhibitorDetails
DB04576FleroxacinexperimentalyesinhibitorDetails
DB06771BesifloxacinapprovedyesantagonistDetails
DB09047Finafloxacinapproved, investigationalyesinhibitorDetails
DB12924Ozenoxacinapproved, investigationalyesinhibitorDetails