Penicillin-binding protein 2

Details

Name
Penicillin-binding protein 2
Synonyms
  • PBP-2
  • pbp2
Gene Name
mrdA
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Amino acid sequence
>lcl|BSEQ0010163|Penicillin-binding protein 2
MNLKKFFNTPTHEPFRDKKAERNLFARRTLVAFLGILLLTGVLFTNIYQLQIVNFDTYQT
RSNGNRIKLLPLPPTRGLIYDRYGKLLAENLTFFGLYIVPEKTENLDRTLDELRYIVGLT
DNDIENFKKERRRGTRYTPILLKPNLTEEQISRFAVNGYQYPSLEVRPYFKRHYLYGETM
AHILGYVGKMNDKDVERLKREDKFANYAGTNDIGKLGIERYYEDILQGTTGFEEVEINNR
GKVIRTLRSRPAVAGKSIHLTIDLALQRYITELLSGLKGAVVVLDPKDSSVLAMVSTPSY
DNNLFVDGISSEDYKRLLNDLARPLYSRATQGAYPPASTVKPFIAVAAQTENVITPNTTI
FDPGYWVLPNSTKRFRDWKKTGHGDTDLNKAITESSDTYFYQVAYNMGIDRLSNWMKDFG
FGMPTGIEIQEETAANIPTREWKQKRYKRPWVQGDTISVGIGQGYWTATPLQVAKATTIL
VNNGKVNTPHLMKAIEGAVLEPYEDPLLYPDINTPKVAAWEAAKRGMYNVVNAANGTGRK
AFADANYRVAGKSGTAQVFSLKENEKYNTAGLKKELHDHAWFTAYAPYDNPKLVVTVILE
NAGGGSSNAAPLARKVMDYYLNQRLPQVEKYNVPIQQKKDLSQESEQINGR
Number of residues
651
Molecular Weight
73812.47
Theoretical pI
9.66
GO Classification
Functions
catalytic activity / penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
integral component of membrane / plasma membrane
General Function
Penicillin binding
Specific Function
Cell wall formation; PBP-2 is responsible for the determination of the rod shape of the cell. Its synthesize cross-linked peptidoglycan from the lipid intermediates (By similarity).
Pfam Domain Function
Transmembrane Regions
30-50
Cellular Location
Cell inner membrane
Gene sequence
>lcl|BSEQ0010164|Penicillin-binding protein 2 (mrdA)
ATGAATTTAAAAAAATTCTTCAATACACCAACGCACGAACCGTTCCGCGATAAAAAAGCG
GAGCGTAACCTTTTTGCACGCCGAACGTTAGTGGCTTTTTTGGGGATTCTGCTCTTAACA
GGCGTGTTATTCACCAATATTTATCAGCTACAGATTGTTAATTTCGATACTTACCAAACG
CGTTCTAATGGTAACCGAATTAAATTATTACCTTTACCGCCAACACGTGGCTTAATCTAT
GATCGTTACGGCAAATTATTAGCCGAAAATCTTACTTTTTTTGGTTTATACATTGTGCCA
GAAAAAACTGAAAATTTAGACCGCACTTTAGATGAATTACGCTATATTGTGGGATTGACG
GATAACGATATTGAAAATTTTAAAAAGGAACGTCGCCGCGGAACGCGTTATACACCGATT
TTATTAAAGCCGAATTTAACAGAAGAACAAATTTCACGCTTTGCGGTAAATGGCTACCAA
TACCCGAGCTTAGAGGTACGTCCTTATTTCAAACGCCATTATTTATATGGCGAAACAATG
GCGCATATTTTGGGCTATGTAGGTAAAATGAATGATAAAGATGTAGAACGTTTGAAACGA
GAGGATAAATTCGCGAATTATGCGGGAACGAACGATATTGGAAAATTGGGTATTGAACGT
TATTACGAGGATATACTGCAAGGTACCACGGGTTTTGAAGAAGTAGAAATTAATAATCGC
GGCAAAGTAATCCGCACTTTGCGTAGCCGACCTGCTGTGGCGGGAAAAAGTATTCATTTA
ACCATTGATTTGGCATTACAGCGTTATATTACTGAACTTTTATCGGGACTAAAAGGTGCT
GTAGTTGTGCTTGATCCGAAAGATAGTAGTGTATTAGCGATGGTATCTACACCAAGTTAT
GATAATAATTTATTTGTTGATGGTATTTCCTCCGAAGATTATAAACGTTTATTAAATGAT
CTTGCTCGTCCACTTTATAGTCGTGCGACACAAGGTGCGTATCCGCCCGCTTCGACAGTC
AAACCTTTTATTGCAGTAGCCGCACAAACTGAAAATGTGATTACACCAAACACAACGATT
TTTGATCCGGGATATTGGGTATTACCTAATTCCACAAAACGTTTTCGTGATTGGAAAAAA
ACAGGCCACGGGGATACGGATTTGAATAAAGCGATTACTGAATCCTCTGATACTTATTTT
TATCAAGTGGCTTATAATATGGGTATTGATCGCCTTTCTAATTGGATGAAGGATTTTGGT
TTTGGTATGCCAACGGGGATTGAAATTCAAGAAGAAACGGCTGCCAATATACCAACTCGA
GAATGGAAACAAAAACGTTATAAACGCCCTTGGGTGCAAGGCGATACGATTTCGGTTGGG
ATTGGTCAAGGTTATTGGACGGCAACACCACTACAAGTAGCAAAAGCGACGACAATATTG
GTCAATAATGGCAAAGTAAATACACCGCATTTGATGAAAGCAATTGAAGGTGCAGTATTA
GAGCCTTATGAAGATCCGTTACTTTATCCTGATATTAATACACCTAAAGTGGCAGCTTGG
GAGGCAGCGAAACGCGGTATGTACAATGTTGTTAATGCTGCAAATGGAACTGGGCGAAAA
GCCTTTGCAGATGCAAATTATCGTGTTGCAGGGAAATCTGGCACTGCACAAGTGTTTAGT
TTAAAGGAAAATGAAAAATATAATACGGCAGGCTTAAAAAAAGAATTGCATGATCACGCT
TGGTTTACCGCTTACGCCCCTTATGATAATCCTAAATTAGTTGTAACAGTGATTTTAGAA
AATGCAGGTGGTGGTTCAAGTAATGCCGCACCCTTAGCACGTAAAGTGATGGATTACTAT
TTAAATCAGCGTTTACCACAAGTTGAAAAATATAATGTACCTATTCAGCAAAAAAAAGAT
TTGTCACAAGAGAGCGAACAAATAAATGGAAGATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP44469
UniProtKB Entry NamePBP2_HAEIN
GenBank Protein ID1572976
GenBank Gene IDL42023
General References
  1. Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA, Merrick JM, et al.: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science. 1995 Jul 28;269(5223):496-512. [PubMed:7542800]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00303Ertapenemapproved, investigationalyesinhibitorDetails
DB00671Cefiximeapproved, investigationalyesinhibitorDetails