Utrophin

Details

Name
Utrophin
Synonyms
  • DMDL
  • DRP-1
  • DRP1
  • Dystrophin-related protein 1
Gene Name
UTRN
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009864|Utrophin
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTAPEEEHESPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELLNWILKWKTAIQTTEIKEYMK
MQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEW
KNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDS
CQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHL
ENELKGQPGHAYLETLKTLKDVLNDSENKAQVSLNVLNDLAKVEKALQEKKTLDEILENQ
KPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALTLRA
FEADSTVIEKWMDGVKDFLMKQQAAQGDDAGLQRQLDQCSAFVNEIETIESSLKNMKEIE
TNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEIATQKSRLSESQEKAANLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKI
QAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMKKEAASLSEWL
SATETELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKADLNTITESSAALQNLIEGSEP
ILEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK
KPTSKQEEIVKRLVSELDDANLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKV
SQHIKSAKLLIAQEPLYQCLVTTETFETGVPFSDLEKLENDIENMLKFVEKHLESSDEDE
KMDEESAQIEEVLQRGEEMLHQPMEDNKKEKIRLQLLLLHTRYNKIKAIPIQQRKMGQLA
SGIRSSLLPTDYLVEINKILLCMDDVELSLNVPELNTAIYEDFSFQEDSLKNIKDQLDKL
GEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYSDRKGCFDRAMEEWRQ
FHCDLNDLTQWITEAEELLVDTCAPGGSLDLEKARIHQQELEVGISSHQPSFAALNRTGD
GIVQKLSQADGSFLKEKLAGLNQRWDAIVAEVKDRQPRLKGESKQVMKYRHQLDEIICWL
TKAEHAMQKRSTTELGENLQELRDLTQEMEVHAEKLKWLNRTELEMLSDKSLSLPERDKI
SESLRTVNMTWNKICREVPTTLKECIQEPSSVSQTRIAAHPNVQKVVLVSSASDIPVQSH
RTSEISIPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRH
PQLDYVFTLAQNLKNKASSSDMRTAITEKLERVKNQWDGTQHGVELRQQQLEDMIIDSLQ
WDDHREETEELMRKYEARLYILQQARRDPLTKQISDNQILLQELGPGDGIVMAFDNVLQK
LLEEYGSDDTRNVKETTEYLKTSWINLKQSIADRQNALEAEWRTVQASRRDLENFLKWIQ
EAETTVNVLVDASHRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKDE
ELKKQMPIGGDVPALQLQYDHCKALRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRR
NLQSKTELTPEERAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINFKVKTVNDLSSQLS
PLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMHLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPS
QSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGLPVGSPPE
SIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDS
RINGVSPWASPQHSALSYSLDPDASGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTFP
SCCPNVPSRPQAM
Number of residues
3433
Molecular Weight
394463.09
Theoretical pI
Not Available
GO Classification
Functions
actin binding / integrin binding / protein kinase binding / vinculin binding / zinc ion binding
Processes
muscle contraction / muscle organ development / positive regulation of cell-matrix adhesion / regulation of sodium ion transmembrane transporter activity
Components
cell junction / cytoplasm / cytoskeleton / dystrophin-associated glycoprotein complex / extracellular exosome / filopodium / filopodium membrane / membrane / neuromuscular junction / nucleoplasm / plasma membrane / postsynaptic membrane / protein complex / sarcolemma
General Function
Zinc ion binding
Specific Function
May play a role in anchoring the cytoskeleton to the plasma membrane.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0021963|Utrophin (UTRN)
ATGGCCAAGTATGGAGAACATGAAGCCAGTCCTGACAATGGGCAGAACGAATTCAGTGAT
ATCATTAAGTCCAGATCTGATGAACACAATGACGTACAGAAGAAAACCTTTACCAAATGG
ATAAATGCTCGATTTTCAAAGAGTGGGAAACCACCCATCAATGATATGTTCACAGACCTC
AAAGATGGAAGGAAGCTATTGGATCTTCTAGAAGGCCTCACAGGAACATCACTGCCAAAG
GAACGTGGTTCCACAAGGGTACATGCCTTAAATAACGTCAACAGAGTGCTGCAGGTTTTA
CATCAGAACAATGTGGAATTAGTGAATATAGGGGGAACTGACATTGTGGATGGAAATCAC
AAACTGACTTTGGGGTTACTTTGGAGCATCATTTTGCACTGGCAGGTGAAAGATGTCATG
AAGGATGTCATGTCGGACCTGCAGCAGACGAACAGTGAGAAGATCCTGCTCAGCTGGGTG
CGTCAGACCACCAGGCCCTACAGCCAAGTCAACGTCCTCAACTTCACCACCAGCTGGACA
GATGGACTCGCCTTTAATGCTGTCCTCCACCGACATAAACCTGATCTCTTCAGCTGGGAT
AAAGTTGTCAAAATGTCACCAATTGAGAGACTTGAACATGCCTTCAGCAAGGCTCAAACT
TATTTGGGAATTGAAAAGCTGTTAGATCCTGAAGATGTTGCCGTTCAGCTTCCTGACAAG
AAATCCATAATTATGTATTTAACATCTTTGTTTGAGGTGCTACCTCAGCAAGTCACCATA
GACGCCATCCGTGAGGTAGAGACACTCCCAAGGAAATATAAAAAAGAATGTGAAGAAGAG
GCAATTAATATACAGAGTACAGCGCCTGAGGAGGAGCATGAGAGTCCCCGAGCTGAAACT
CCCAGCACTGTCACTGAGGTTGACATGGATCTGGACAGCTATCAGATTGCGTTGGAGGAA
GTGCTGACCTGGTTGCTTTCTGCTGAGGACACTTTCCAGGAGCAGGATGATATTTCTGAT
GATGTTGAAGAAGTCAAAGACCAGTTTGCAACCCATGAAGCTTTTATGATGGAACTGACT
GCACACCAGAGCAGTGTGGGCAGCGTCCTGCAGGCAGGCAACCAACTGATAACACAAGGA
ACTCTGTCAGACGAAGAAGAATTTGAGATTCAGGAACAGATGACCCTGCTGAATGCTAGA
TGGGAGGCTCTTAGGGTGGAGAGTATGGACAGACAGTCCCGGCTGCACGATGTGCTGATG
GAACTGCAGAAGAAGCAACTGCAGCAGCTCTCCGCCTGGTTAACACTCACAGAGGAGCGC
ATTCAGAAGATGGAAACTTGCCCCCTGGATGATGATGTAAAATCTCTACAAAAGCTGCTA
GAAGAACATAAAAGTTTGCAAAGTGATCTTGAGGCTGAACAGGTGAAAGTAAATTCACTA
ACTCACATGGTGGTCATTGTTGATGAAAACAGTGGTGAGAGTGCTACAGCTATCCTAGAA
GACCAGTTACAGAAACTTGGTGAGCGCTGGACAGCAGTATGCCGTTGGACTGAAGAACGC
TGGAATAGGTTACAAGAAATCAATATATTGTGGCAGGAATTATTGGAAGAACAGTGCTTG
TTGAAAGCTTGGTTAACCGAAAAAGAAGAGGCTTTAAATAAAGTCCAGACAAGCAACTTC
AAAGACCAAAAGGAACTAAGTGTCAGTGTTCGACGTCTGGCTATTTTGAAGGAAGACATG
GAAATGAAGCGTCAAACATTGGATCAGCTGAGTGAGATTGGCCAGGATGTGGGACAATTA
CTTGATAATTCCAAGGCATCTAAGAAGATCAACAGTGACTCAGAGGAACTGACTCAAAGA
TGGGATTCTTTGGTTCAGAGACTAGAAGATTCCTCCAACCAGGTGACTCAGGCTGTAGCA
AAGCTGGGGATGTCTCAGATTCCTCAGAAGGACCTTTTGGAGACTGTTCGTGTAAGAGAA
CAAGCAATTACAAAAAAATCTAAGCAGGAACTGCCTCCTCCTCCTCCCCCAAAGAAGAGA
CAGATCCATGTGGATATTGAAGCTAAGAAAAAGTTTGATGCTATAAGTGCAGAGCTGTTG
AACTGGATTTTGAAATGGAAAACTGCCATTCAGACCACAGAGATAAAAGAGTATATGAAG
ATGCAAGACACTTCCGAAATGAAAAAGAAGTTGAAGGCATTAGAAAAAGAACAGAGAGAA
AGAATCCCCAGAGCAGATGAATTAAACCAAACTGGACAAATCCTTGTGGAGCAAATGGGA
AAAGAAGGCCTTCCTACTGAAGAAATAAAAAATGTTCTGGAGAAGGTTTCATCAGAATGG
AAGAATGTATCTCAACATTTGGAAGATCTAGAAAGAAAGATTCAGCTACAGGAAGATATA
AATGCTTATTTCAAGCAGCTTGATGAGCTTGAAAAGGTCATCAAGACAAAGGAGGAGTGG
GTAAAACACACTTCCATTTCTGAATCTTCCCGGCAGTCCTTGCCAAGCTTGAAGGATTCC
TGTCAGCGGGAATTGACAAATCTTCTTGGCCTTCACCCCAAAATTGAAATGGCTCGTGCA
AGCTGCTCGGCCCTGATGTCTCAGCCTTCTGCCCCAGATTTTGTCCAGCGGGGCTTCGAT
AGCTTTCTGGGCCGCTACCAAGCTGTACAAGAGGCTGTAGAGGATCGTCAACAACATCTA
GAGAATGAACTGAAGGGCCAACCTGGACATGCATATCTGGAAACATTGAAAACACTGAAA
GATGTGCTAAATGATTCAGAAAATAAGGCCCAGGTGTCTCTGAATGTCCTTAATGATCTT
GCCAAGGTGGAGAAGGCCCTGCAAGAAAAAAAGACCCTTGATGAAATCCTTGAGAATCAG
AAACCTGCATTACATAAACTTGCAGAAGAAACAAAGGCTCTGGAGAAAAATGTTCATCCT
GATGTAGAAAAATTATATAAGCAAGAATTTGATGATGTGCAAGGAAAGTGGAACAAGCTA
AAGGTCTTGGTTTCCAAAGATCTACATTTGCTTGAGGAAATTGCTCTCACACTCAGAGCT
TTTGAGGCCGATTCAACAGTCATTGAGAAGTGGATGGATGGCGTGAAAGACTTCTTAATG
AAACAGCAGGCTGCCCAAGGAGACGACGCAGGTCTACAGAGGCAGTTAGACCAGTGCTCT
GCATTTGTTAATGAAATAGAAACAATTGAATCATCTCTGAAAAACATGAAGGAAATAGAG
ACTAATCTTCGAAGTGGTCCAGTTGCTGGAATAAAAACTTGGGTGCAGACAAGACTAGGT
GACTACCAAACTCAACTGGAGAAACTTAGCAAGGAGATCGCTACTCAAAAAAGTAGGTTG
TCTGAAAGTCAAGAAAAAGCTGCGAACCTGAAGAAAGACTTGGCAGAGATGCAGGAATGG
ATGACCCAGGCCGAGGAAGAATATTTGGAGCGGGATTTTGAGTACAAGTCACCAGAAGAG
CTTGAGAGTGCTGTGGAAGAGATGAAGAGGGCAAAAGAGGATGTGTTGCAGAAGGAGGTG
AGAGTGAAGATTCTCAAGGACAACATCAAGTTATTAGCTGCCAAGGTGCCCTCTGGTGGC
CAGGAGTTGACGTCTGAGCTGAATGTTGTGCTGGAGAATTACCAACTTCTTTGTAATAGA
ATTCGAGGAAAGTGCCACACGCTAGAGGAGGTCTGGTCTTGTTGGATTGAACTGCTTCAC
TATTTGGATCTTGAAACTACCTGGTTAAACACTTTGGAAGAGCGGATGAAGAGCACAGAG
GTCCTGCCTGAGAAGACGGATGCTGTCAACGAAGCCCTGGAGTCTCTGGAATCTGTTCTG
CGCCACCCGGCAGATAATCGCACCCAGATTCGAGAGCTTGGCCAGACTCTGATTGATGGG
GGGATCCTGGATGATATAATCAGTGAGAAACTGGAGGCTTTCAACAGCCGATATGAAGAT
CTAAGTCACCTGGCAGAGAGCAAGCAGATTTCTTTGGAAAAGCAACTCCAGGTGCTGCGG
GAAACTGACCAGATGCTTCAAGTCTTGCAAGAGAGCTTGGGGGAGCTGGACAAACAGCTC
ACCACATACCTGACTGACAGGATAGATGCTTTCCAAGTTCCACAGGAAGCTCAGAAAATC
CAAGCAGAGATCTCAGCCCATGAGCTAACCCTAGAGGAGTTGAGAAGAAATATGCGTTCT
CAGCCCCTGACCTCCCCAGAGAGTAGGACTGCCAGAGGAGGAAGTCAGATGGATGTGCTA
CAGAGGAAACTCCGAGAGGTGTCCACAAAGTTCCAGCTTTTCCAGAAGCCAGCTAACTTC
GAGCAGCGCATGCTGGACTGCAAGCGTGTGCTGGATGGCGTGAAAGCAGAACTTCACGTT
CTGGATGTGAAGGACGTAGACCCTGACGTCATACAGACGCACCTGGACAAGTGTATGAAA
CTGTATAAAACTTTGAGTGAAGTCAAACTTGAAGTGGAAACTGTGATTAAAACAGGAAGA
CATATTGTCCAGAAACAGCAAACGGACAACCCAAAAGGGATGGATGAGCAGCTGACTTCC
CTGAAGGTTCTTTACAATGACCTGGGCGCACAGGTGACAGAAGGAAAACAGGATCTGGAA
AGAGCATCACAGTTGGCCCGGAAAATGAAGAAAGAGGCTGCTTCTCTCTCTGAATGGCTT
TCTGCTACTGAAACTGAATTGGTACAGAAGTCCACTTCAGAAGGTCTGCTTGGTGACTTG
GATACAGAAATTTCCTGGGCTAAAAATGTTCTGAAGGATCTGGAAAAGAGAAAAGCTGAT
TTAAATACCATCACAGAGAGTAGTGCTGCCCTGCAAAACTTGATTGAGGGCAGTGAGCCT
ATTTTAGAAGAGAGGCTCTGCGTCCTTAACGCTGGGTGGAGCCGAGTTCGTACCTGGACT
GAAGATTGGTGCAATACCTTGATGAACCATCAGAACCAGCTAGAAATATTTGATGGGAAC
GTGGCTCACATAAGTACCTGGCTTTATCAAGCTGAAGCTCTATTGGATGAAATTGAAAAG
AAACCAACAAGTAAACAGGAAGAAATTGTGAAGCGTTTAGTATCTGAGCTGGATGATGCC
AACCTCCAGGTTGAAAATGTCCGCGATCAAGCCCTTATTTTGATGAATGCCCGTGGAAGC
TCAAGCAGGGAGCTTGTAGAACCAAAGTTAGCTGAGCTGAATAGGAACTTTGAAAAGGTG
TCTCAACATATCAAAAGTGCCAAATTGCTAATTGCTCAGGAACCATTATACCAATGTTTG
GTCACCACTGAAACATTTGAAACTGGTGTGCCTTTCTCTGACTTGGAAAAATTAGAAAAT
GACATAGAAAATATGTTAAAATTTGTGGAAAAACACTTGGAATCCAGTGATGAAGATGAA
AAGATGGATGAGGAGAGTGCCCAGATTGAGGAAGTTCTACAAAGAGGAGAAGAAATGTTA
CATCAACCTATGGAAGATAATAAAAAAGAAAAGATCCGTTTGCAATTATTACTTTTGCAT
ACTAGATACAACAAAATTAAGGCAATCCCTATTCAACAGAGGAAAATGGGTCAACTTGCT
TCTGGAATTAGATCATCACTTCTTCCTACAGATTATCTGGTTGAAATTAACAAAATTTTA
CTTTGCATGGATGATGTTGAATTATCGCTTAATGTTCCAGAGCTCAACACTGCTATTTAC
GAAGACTTCTCTTTTCAGGAAGACTCTCTGAAGAATATCAAAGACCAACTGGACAAACTT
GGAGAGCAGATTGCAGTCATTCATGAAAAACAGCCAGATGTCATCCTTGAAGCCTCTGGA
CCTGAAGCCATTCAGATCAGAGATACACTTACTCAGCTGAATGCAAAATGGGACAGAATT
AATAGAATGTACAGTGATCGGAAAGGTTGTTTTGACAGGGCAATGGAAGAATGGAGACAG
TTCCATTGTGACCTTAATGACCTCACACAGTGGATAACAGAGGCTGAAGAATTACTGGTT
GATACCTGTGCTCCAGGTGGCAGCCTGGACTTAGAGAAAGCCAGGATACATCAGCAGGAA
CTTGAGGTGGGCATCAGCAGCCACCAGCCCAGTTTTGCAGCACTAAACCGAACTGGGGAT
GGGATTGTGCAGAAACTCTCCCAGGCAGATGGAAGCTTCTTGAAAGAAAAACTGGCAGGT
TTAAACCAACGCTGGGATGCAATTGTTGCAGAAGTGAAGGATAGGCAGCCAAGGCTAAAA
GGAGAAAGTAAGCAGGTGATGAAGTACAGGCATCAGCTAGATGAGATTATCTGTTGGTTA
ACAAAGGCTGAGCATGCTATGCAAAAGAGATCAACCACCGAATTGGGAGAAAACCTGCAA
GAATTAAGAGACTTAACTCAAGAAATGGAAGTACATGCTGAAAAACTCAAATGGCTGAAT
AGAACTGAATTGGAGATGCTTTCAGATAAAAGTCTGAGTTTACCTGAAAGGGATAAAATT
TCAGAAAGCTTAAGGACTGTAAATATGACATGGAATAAGATTTGCAGAGAGGTGCCTACC
ACCCTGAAGGAATGCATCCAGGAGCCCAGTTCTGTTTCACAGACAAGGATTGCTGCTCAT
CCTAATGTCCAAAAGGTGGTGCTAGTATCATCTGCGTCAGATATTCCTGTTCAGTCTCAT
CGTACTTCGGAAATTTCAATTCCTGCTGATCTTGATAAAACTATAACAGAACTAGCCGAC
TGGCTGGTATTAATCGACCAGATGCTGAAGTCCAACATTGTCACTGTTGGGGATGTAGAA
GAGATCAATAAGACCGTTTCCCGAATGAAAATTACAAAGGCTGACTTAGAACAGCGCCAT
CCTCAGCTGGATTATGTTTTTACATTGGCACAGAATTTGAAAAATAAAGCTTCCAGTTCA
GATATGAGAACAGCAATTACAGAAAAATTGGAAAGGGTCAAGAACCAGTGGGATGGCACC
CAGCATGGCGTTGAGCTAAGACAGCAGCAGCTTGAGGACATGATTATTGACAGTCTTCAG
TGGGATGACCATAGGGAGGAGACTGAAGAACTGATGAGAAAATATGAGGCTCGACTCTAT
ATTCTTCAGCAAGCCCGACGGGATCCACTCACCAAACAAATTTCTGATAACCAAATACTG
CTTCAAGAACTGGGTCCTGGAGATGGTATCGTCATGGCGTTCGATAACGTCCTGCAGAAA
CTCCTGGAGGAATATGGGAGTGATGACACAAGGAATGTGAAAGAAACCACAGAGTACTTA
AAAACATCATGGATCAATCTCAAACAAAGTATTGCTGACAGACAGAACGCCTTGGAGGCT
GAGTGGAGGACGGTGCAGGCCTCTCGCAGAGATCTGGAAAACTTCCTGAAGTGGATCCAA
GAAGCAGAGACCACAGTGAATGTGCTTGTGGATGCCTCTCATCGGGAGAATGCTCTTCAG
GATAGTATCTTGGCCAGGGAACTCAAACAGCAGATGCAGGACATCCAGGCAGAAATTGAT
GCCCACAATGACATATTTAAAAGCATTGACGGAAACAGGCAGAAGATGGTAAAAGCTTTG
GGAAATTCTGAAGAGGCTACTATGCTTCAACATCGACTGGATGATATGAACCAAAGATGG
AATGACTTAAAAGCAAAATCTGCTAGCATCAGGGCCCATTTGGAGGCCAGCGCTGAGAAG
TGGAACAGGTTGCTGATGTCCTTAGAAGAACTGATCAAATGGCTGAATATGAAAGATGAA
GAGCTTAAGAAACAAATGCCTATTGGAGGAGATGTTCCAGCCTTACAGCTCCAGTATGAC
CATTGTAAGGCCCTGAGACGGGAGTTAAAGGAGAAAGAATATTCTGTCCTGAATGCTGTC
GACCAGGCCCGAGTTTTCTTGGCTGATCAGCCAATTGAGGCCCCTGAAGAGCCAAGAAGA
AACCTACAATCAAAAACAGAATTAACTCCTGAGGAGAGAGCCCAAAAGATTGCCAAAGCC
ATGCGCAAACAGTCTTCTGAAGTCAAAGAAAAATGGGAAAGTCTAAATGCTGTAACTAGC
AATTGGCAAAAGCAAGTGGACAAGGCATTGGAGAAACTCAGAGACCTGCAGGGAGCTATG
GATGACCTGGACGCTGACATGAAGGAGGCAGAGTCCGTGCGGAATGGCTGGAAGCCCGTG
GGAGACTTACTCATTGACTCGCTGCAGGATCACATTGAAAAAATCATGGCATTTAGAGAA
GAAATTGCACCAATCAACTTTAAAGTTAAAACGGTGAATGATTTATCCAGTCAGCTGTCT
CCACTTGACCTGCATCCCTCTCTAAAGATGTCTCGCCAGCTAGATGACCTTAATATGCGA
TGGAAACTTTTACAGGTTTCTGTGGATGATCGCCTTAAACAGCTTCAGGAAGCCCACAGA
GATTTTGGACCATCCTCTCAGCATTTTCTCTCTACGTCAGTCCAGCTGCCGTGGCAAAGA
TCCATTTCACATAATAAAGTGCCCTATTACATCAACCATCAAACACAGACCACCTGTTGG
GACCATCCTAAAATGACCGAACTCTTTCAATCCCTTGCTGACCTGAATAATGTACGTTTT
TCTGCCTACCGTACAGCAATCAAAATCCGAAGACTACAAAAAGCACTATGTTTGGATCTC
TTAGAGTTGAGTACAACAAATGAAATTTTCAAACAGCACAAGTTGAACCAAAATGACCAG
CTCCTCAGTGTTCCAGATGTCATCAACTGTCTGACAACAACTTATGATGGACTTGAGCAA
ATGCATAAGGACCTGGTCAACGTTCCACTCTGTGTTGATATGTGTCTCAATTGGTTGCTC
AATGTCTATGACACGGGTCGAACTGGAAAAATTAGAGTGCAGAGTCTGAAGATTGGATTA
ATGTCTCTCTCCAAAGGTCTCTTGGAAGAAAAATACAGATATCTCTTTAAGGAAGTTGCA
GGGCCAACAGAAATGTGTGACCAGAGGCAGCTGGGCCTGTTACTTCATGATGCCATCCAG
ATCCCCCGGCAGCTAGGTGAAGTAGCAGCTTTTGGAGGCAGTAATATTGAGCCTAGTGTT
CGCAGCTGCTTCCAACAGAATAACAATAAACCAGAAATAAGTGTGAAAGAGTTTATAGAT
TGGATGCATTTGGAACCACAGTCCATGGTTTGGCTCCCAGTTTTACATCGAGTGGCAGCA
GCGGAGACTGCAAAACATCAGGCCAAATGCAACATCTGTAAAGAATGTCCAATTGTCGGG
TTCAGGTATAGAAGCCTTAAGCATTTTAACTATGATGTCTGCCAGAGTTGTTTCTTTTCG
GGTCGAACAGCAAAAGGTCACAAATTACATTACCCAATGGTGGAATATTGTATACCTACA
ACATCTGGGGAAGATGTACGAGACTTCACAAAGGTACTTAAGAACAAGTTCAGGTCGAAG
AAGTACTTTGCCAAACACCCTCGACTTGGTTACCTGCCTGTCCAGACAGTTCTTGAAGGT
GACAACTTAGAGACTCCTATCACACTCATCAGTATGTGGCCAGAGCACTATGACCCCTCA
CAATCTCCTCAACTGTTTCATGATGACACCCATTCAAGAATAGAACAATATGCCACACGA
CTGGCCCAGATGGAAAGGACTAATGGGTCTTTTCTCACTGATAGCAGCTCCACCACAGGA
AGTGTGGAAGACGAGCACGCCCTCATCCAGCAGTATTGCCAAACACTCGGAGGAGAGTCC
CCAGTGAGCCAGCCGCAGAGCCCAGCTCAGATCCTGAAGTCAGTAGAGAGGGAAGAACGT
GGAGAACTGGAGAGGATCATTGCTGACCTGGAGGAAGAACAAAGAAATCTACAGGTGGAG
TATGAGCAGCTGAAGGACCAGCACCTCCGAAGGGGGCTCCCTGTCGGTTCACCGCCAGAG
TCGATTATATCTCCCCATCACACGTCTGAGGATTCAGAACTTATAGCAGAAGCAAAACTC
CTCAGGCAGCACAAAGGTCGGCTGGAGGCTAGGATGCAGATTTTAGAAGATCACAATAAA
CAGCTGGAGTCTCAGCTCCACCGCCTCCGACAGCTGCTGGAGCAGCCTGAATCTGATTCC
CGAATCAATGGTGTTTCCCCATGGGCTTCTCCTCAGCATTCTGCACTGAGCTACTCGCTT
GATCCAGATGCCTCCGGCCCACAGTTCCACCAGGCAGCGGGAGAGGACCTGCTGGCCCCA
CCGCACGACACCAGCACGGATCTCACGGAGGTCATGGAGCAGATTCACAGCACGTTTCCA
TCTTGCTGCCCAAATGTTCCCAGCAGGCCACAGGCAATGTGA
Chromosome Location
6
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP46939
UniProtKB Entry NameUTRO_HUMAN
HGNC IDHGNC:12635
General References
  1. Tinsley JM, Blake DJ, Roche A, Fairbrother U, Riss J, Byth BC, Knight AE, Kendrick-Jones J, Suthers GK, Love DR, et al.: Primary structure of dystrophin-related protein. Nature. 1992 Dec 10;360(6404):591-3. [PubMed:1461283]
  2. Wilson J, Putt W, Jimenez C, Edwards YH: Up71 and up140, two novel transcripts of utrophin that are homologues of short forms of dystrophin. Hum Mol Genet. 1999 Jul;8(7):1271-8. [PubMed:10369873]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Burton EA, Tinsley JM, Holzfeind PJ, Rodrigues NR, Davies KE: A second promoter provides an alternative target for therapeutic up-regulation of utrophin in Duchenne muscular dystrophy. Proc Natl Acad Sci U S A. 1999 Nov 23;96(24):14025-30. [PubMed:10570192]
  5. Ahn AH, Kunkel LM: Syntrophin binds to an alternatively spliced exon of dystrophin. J Cell Biol. 1995 Feb;128(3):363-71. [PubMed:7844150]
  6. Ahn AH, Freener CA, Gussoni E, Yoshida M, Ozawa E, Kunkel LM: The three human syntrophin genes are expressed in diverse tissues, have distinct chromosomal locations, and each bind to dystrophin and its relatives. J Biol Chem. 1996 Feb 2;271(5):2724-30. [PubMed:8576247]
  7. Tommasi di Vignano A, Di Zenzo G, Sudol M, Cesareni G, Dente L: Contribution of the different modules in the utrophin carboxy-terminal region to the formation and regulation of the DAP complex. FEBS Lett. 2000 Apr 14;471(2-3):229-34. [PubMed:10767429]
  8. James M, Nuttall A, Ilsley JL, Ottersbach K, Tinsley JM, Sudol M, Winder SJ: Adhesion-dependent tyrosine phosphorylation of (beta)-dystroglycan regulates its interaction with utrophin. J Cell Sci. 2000 May;113 ( Pt 10):1717-26. [PubMed:10769203]
  9. Bhosle RC, Michele DE, Campbell KP, Li Z, Robson RM: Interactions of intermediate filament protein synemin with dystrophin and utrophin. Biochem Biophys Res Commun. 2006 Aug 4;346(3):768-77. Epub 2006 Jun 9. [PubMed:16777071]
  10. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  11. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  12. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  13. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  15. Singh SM, Bandi S, Winder SJ, Mallela KM: The actin binding affinity of the utrophin tandem calponin-homology domain is primarily determined by its N-terminal domain. Biochemistry. 2014 Mar 25;53(11):1801-9. doi: 10.1021/bi500149q. Epub 2014 Mar 14. [PubMed:24628267]
  16. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  17. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  18. Keep NH, Norwood FL, Moores CA, Winder SJ, Kendrick-Jones J: The 2.0 A structure of the second calponin homology domain from the actin-binding region of the dystrophin homologue utrophin. J Mol Biol. 1999 Jan 22;285(3):1257-64. [PubMed:9887274]
  19. Keep NH, Winder SJ, Moores CA, Walke S, Norwood FL, Kendrick-Jones J: Crystal structure of the actin-binding region of utrophin reveals a head-to-tail dimer. Structure. 1999 Dec 15;7(12):1539-46. [PubMed:10647184]
  20. Moores CA, Keep NH, Kendrick-Jones J: Structure of the utrophin actin-binding domain bound to F-actin reveals binding by an induced fit mechanism. J Mol Biol. 2000 Mar 24;297(2):465-80. [PubMed:10715214]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails