Inward rectifier potassium channel 4

Details

Name
Inward rectifier potassium channel 4
Synonyms
  • Hippocampal inward rectifier
  • HIR
  • HIRK2
  • HRK1
  • Inward rectifier K(+) channel Kir2.3
  • IRK-3
  • IRK3
  • Potassium channel, inwardly rectifying subfamily J member 4
Gene Name
KCNJ4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017646|Inward rectifier potassium channel 4
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
Number of residues
445
Molecular Weight
49499.61
Theoretical pI
Not Available
GO Classification
Functions
inward rectifier potassium channel activity / PDZ domain binding
Processes
cellular response to mechanical stimulus / potassium ion import / potassium ion transport / regulation of ion transmembrane transport / synaptic transmission
Components
basolateral plasma membrane / cell junction / cytoplasmic vesicle membrane / dendrite / integral component of plasma membrane / neuronal cell body / plasma membrane / postsynaptic membrane / voltage-gated potassium channel complex
General Function
Pdz domain binding
Specific Function
Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity).
Pfam Domain Function
Transmembrane Regions
56-80 149-170
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017647|Inward rectifier potassium channel 4 (KCNJ4)
ATGCACGGACACAGCCGCAACGGCCAGGCCCACGTGCCCCGGCGGAAGCGCCGCAACCGC
TTCGTCAAGAAGAACGGCCAATGCAACGTGTACTTCGCCAACCTGAGCAACAAGTCGCAG
CGCTACATGGCGGACATCTTCACCACCTGCGTGGACACGCGCTGGCGCTACATGCTCATG
ATCTTCTCCGCGGCCTTCCTTGTCTCCTGGCTCTTTTTCGGCCTCCTCTTCTGGTGTATC
GCCTTCTTCCACGGTGACCTGGAGGCCAGCCCAGGGGTGCCTGCGGCGGGGGGCCCGGCG
GCGGGTGGTGGCGGAGCAGCCCCGGTGGCCCCCAAGCCCTGCATCATGCACGTGAACGGC
TTCCTGGGTGCCTTCCTGTTCTCGGTGGAGACGCAGACGACCATCGGCTATGGGTTCCGG
TGCGTGACAGAGGAGTGCCCGCTGGCAGTCATCGCTGTGGTGGTCCAGTCCATCGTGGGC
TGCGTCATCGACTCCTTCATGATTGGCACCATCATGGCCAAGATGGCGCGGCCCAAGAAG
CGGGCGCAGACGTTGCTGTTCAGCCACCACGCGGTCATTTCGGTGCGCGACGGCAAGCTC
TGCCTCATGTGGCGCGTGGGCAACCTGCGCAAGAGCCACATTGTGGAGGCCCACGTGCGG
GCCCAGCTCATCAAGCCCTACATGACCCAGGAGGGCGAGTACCTGCCCCTGGACCAGCGG
GACCTCAACGTGGGCTATGACATCGGCCTGGACCGCATCTTCCTGGTGTCGCCCATCATC
ATTGTCCACGAGATCGACGAGGACAGCCCGCTTTATGGCATGGGCAAGGAGGAGCTGGAG
TCGGAGGACTTTGAGATCGTGGTCATCCTGGAGGGCATGGTGGAGGCCACGGCCATGACC
ACCCAGGCCCGCAGCTCCTACCTGGCCAGCGAGATCCTGTGGGGCCACCGCTTTGAGCCT
GTGGTCTTCGAGGAGAAGAGCCACTACAAGGTGGACTACTCACGTTTTCACAAGACCTAC
GAGGTGGCCGGCACGCCCTGCTGCTCGGCCCGGGAGCTGCAGGAGAGTAAGATCACCGTG
CTGCCCGCCCCACCGCCCCCTCCCAGTGCCTTCTGCTACGAGAACGAGCTGGCCCTTATG
AGCCAGGAGGAAGAGGAGATGGAGGAGGAGGCAGCTGCGGCGGCCGCGGTGGCCGCAGGC
CTGGGCCTGGAGGCGGGTTCCAAGGAGGAGGCGGGCATCATCCGGATGCTGGAGTTCGGC
AGCCACCTGGACCTGGAGCGCATGCAGGCTTCCCTCCCGCTGGACAACATCTCCTACCGC
AGGGAGTCTGCCATCTGA
Chromosome Location
22
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP48050
UniProtKB Entry NameKCNJ4_HUMAN
HGNC IDHGNC:6265
General References
  1. Perier F, Radeke CM, Vandenberg CA: Primary structure and characterization of a small-conductance inwardly rectifying potassium channel from human hippocampus. Proc Natl Acad Sci U S A. 1994 Jun 21;91(13):6240-4. [PubMed:8016146]
  2. Tang W, Yang XC: Cloning a novel human brain inward rectifier potassium channel and its functional expression in Xenopus oocytes. FEBS Lett. 1994 Jul 18;348(3):239-43. [PubMed:8034048]
  3. Makhina EN, Kelly AJ, Lopatin AN, Mercer RW, Nichols CG: Cloning and expression of a novel human brain inward rectifier potassium channel. J Biol Chem. 1994 Aug 12;269(32):20468-74. [PubMed:8051145]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802]
  5. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Coulter KL, Perier F, Radeke CM, Vandenberg CA: Identification and molecular localization of a pH-sensing domain for the inward rectifier potassium channel HIR. Neuron. 1995 Nov;15(5):1157-68. [PubMed:7576658]
  8. Preisig-Muller R, Schlichthorl G, Goerge T, Heinen S, Bruggemann A, Rajan S, Derst C, Veh RW, Daut J: Heteromerization of Kir2.x potassium channels contributes to the phenotype of Andersen's syndrome. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7774-9. [PubMed:12032359]
  9. Yan X, Zhou H, Zhang J, Shi C, Xie X, Wu Y, Tian C, Shen Y, Long J: Molecular mechanism of inward rectifier potassium channel 2.3 regulation by tax-interacting protein-1. J Mol Biol. 2009 Oct 2;392(4):967-76. doi: 10.1016/j.jmb.2009.07.060. Epub 2009 Jul 25. [PubMed:19635485]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01136Carvedilolapproved, investigationalunknowninhibitorDetails
DB00243Ranolazineapproved, investigationalunknowninhibitorDetails
DB04855DronedaroneapprovedyesinhibitorDetails