Sodium- and chloride-dependent GABA transporter 3

Details

Name
Sodium- and chloride-dependent GABA transporter 3
Synonyms
  • GABT3
  • GAT-3
  • GAT3
  • Solute carrier family 6 member 11
Gene Name
SLC6A11
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008584|Sodium- and chloride-dependent GABA transporter 3
MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKY
NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Number of residues
632
Molecular Weight
70605.145
Theoretical pI
Not Available
GO Classification
Functions
gamma-aminobutyric acid / neurotransmitter / neurotransmitter binding
Processes
brain development / gamma-aminobutyric acid transport / neurotransmitter secretion / neurotransmitter transport / response to drug / synaptic transmission / transmembrane transport
Components
cytoplasm / integral component of membrane / integral component of plasma membrane / neuron projection / plasma membrane
General Function
Neurotransmitter:sodium symporter activity
Specific Function
Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Pfam Domain Function
Transmembrane Regions
59-79 87-106 131-151 226-244 253-270 306-323 335-356 389-408 438-456 473-493 514-533 553-571
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0013287|Sodium- and chloride-dependent GABA transporter 3 (SLC6A11)
ATGACGGCGGAGAAGGCGCTGCCCCTGGGCAATGGGAAGGCTGCTGAGGAGGCGCGGGAG
TCCGAGGCGCCGGGTGGCGGCTGCAGCAGCGGGGGCGCGGCGCCCGCGCGCCACCCGCGC
GTCAAGCGCGACAAGGCGGTCCACGAGCGCGGCCACTGGAACAACAAGGTGGAGTTCGTG
CTGAGCGTGGCCGGGGAGATCATTGGGCTGGGCAACGTGTGGCGCTTCCCCTACCTGTGC
TACAAGAACGGAGGAGGGGCATTCCTGATTCCCTACGTGGTGTTTTTTATTTGCTGTGGA
ATTCCTGTTTTTTTCCTGGAGACAGCTCTGGGGCAGTTCACAAGTGAAGGTGGCATTACG
TGTTGGAGGAAAGTTTGCCCTTTATTTGAAGGCATTGGCTATGCAACACAGGTGATTGAG
GCCCATCTGAATGTGTACTACATCATCATCCTGGCATGGGCCATTTTTTACCTGAGCAAC
TGCTTCACTACTGAGCTACCCTGGGCTACCTGTGGGCATGAGTGGAACACAGAGAATTGT
GTGGAGTTCCAGAAACTGAATGTGAGCAACTACAGCCATGTGTCTCTGCAGAATGCCACC
TCCCCTGTCATGGAGTTTTGGGAGCACCGGGTCCTGGCCATCTCTGACGGGATCGAGCAC
ATCGGGAACCTTCGCTGGGAGCTGGCCTTGTGTCTCTTGGCAGCCTGGACCATCTGTTAC
TTCTGTATCTGGAAGGGGACCAAGTCTACAGGAAAGGTTGTATACGTGACTGCGACATTC
CCCTACATCATGCTGCTGATCCTCCTGATACGAGGGGTCACGTTGCCCGGGGCCTCAGAG
GGCATCAAGTTCTACTTGTACCCTGACCTCTCCCGGCTCTCCGACCCCCAGGTCTGGGTA
GATGCTGGAACGCAGATCTTTTTCTCCTATGCCATTTGCCTGGGCTGTCTGACCGCTCTG
GGAAGTTATAACAATTATAACAACAACTGCTACAGGGACTGCATCATGCTCTGTTGCCTG
AACAGCGGCACCAGCTTCGTGGCTGGGTTTGCCATCTTCTCAGTCCTGGGTTTTATGGCG
TACGAGCAGGGGGTACCCATTGCTGAGGTGGCAGAGTCAGGCCCCGGCCTGGCCTTTATT
GCGTACCCCAAGGCGGTCACCATGATGCCTCTCTCCCCGCTGTGGGCCACCTTGTTCTTC
ATGATGCTCATCTTCCTGGGCCTGGACAGCCAGTTTGTGTGTGTGGAAAGCCTGGTGACC
GCCGTGGTGGACATGTACCCCAAGGTTTTCCGGAGGGGTTACCGGCGGGAGCTGCTCATC
CTAGCCTTGTCTGTTATCTCCTATTTTCTGGGCCTCGTGATGTTAACAGAGGGTGGCATG
TACATCTTCCAGCTCTTTGACTCCTATGCCGCCAGTGGGATGTGCCTTCTCTTCGTGGCC
ATCTTTGAGTGCATCTGCATCGGCTGGGTGTATGGAAGCAACCGGTTCTATGATAACATT
GAAGACATGATTGGCTACCGGCCACCGTCGCTCATTAAGTGGTGCTGGATGATCATGACC
CCTGGGATCTGCGCGGGGATCTTCATCTTCTTCTTGATCAAGTACAAGCCACTCAAGTAC
AACAACATCTACACCTACCCAGCCTGGGGCTATGGCATTGGCTGGCTCATGGCCCTGTCC
TCCATGCTCTGCATCCCGCTCTGGATCTGCATCACAGTGTGGAAGACGGAGGGGACACTG
CCCGAGAAACTCCAGAAGTTGACGACCCCCAGCACAGATCTGAAAATGCGGGGCAAGCTT
GGGGTGAGCCCACGGATGGTGACAGTTAATGACTGTGATGCCAAACTCAAGAGTGACGGG
ACCATCGCAGCCATCACAGAGAAGGAGACGCACTTCTGA
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP48066
UniProtKB Entry NameS6A11_HUMAN
HGNC IDHGNC:11044
General References
  1. Borden LA, Dhar TG, Smith KE, Branchek TA, Gluchowski C, Weinshank RL: Cloning of the human homologue of the GABA transporter GAT-3 and identification of a novel inhibitor with selectivity for this site. Receptors Channels. 1994;2(3):207-13. [PubMed:7874447]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00349Clobazamapproved, illicityesotherDetails
DB08848GuvacineexperimentalunknowninhibitorDetails