Gamma-aminobutyric acid receptor subunit alpha-4

Details

Name
Gamma-aminobutyric acid receptor subunit alpha-4
Synonyms
  • GABA(A) receptor subunit alpha-4
Gene Name
GABRA4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0018959|Gamma-aminobutyric acid receptor subunit alpha-4
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
Number of residues
554
Molecular Weight
61622.645
Theoretical pI
10.0
GO Classification
Functions
benzodiazepine receptor activity / chloride channel activity / GABA-A receptor activity / inhibitory extracellular ligand-gated ion channel activity
Processes
central nervous system development / chloride transmembrane transport / gamma-aminobutyric acid signaling pathway / ion transmembrane transport / neurological system process / regulation of membrane potential / regulation of response to drug / response to drug / synaptic transmission / transmembrane transport / transport
Components
cell junction / chloride channel complex / GABA-A receptor complex / integral component of plasma membrane / neuron projection / plasma membrane / postsynaptic membrane / synapse
General Function
Inhibitory extracellular ligand-gated ion channel activity
Specific Function
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions
259-280 285-306 318-340 524-543
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0018960|Gamma-aminobutyric acid receptor subunit alpha-4 (GABRA4)
ATGGTTTCTGCCAAGAAGGTACCCGCGATCGCTCTGTCCGCCGGGGTCAGTTTCGCCCTC
CTGCGCTTCCTGTGCCTGGCGGTTTGTTTAAACGAATCCCCAGGACAGAACCAAAAGGAG
GAGAAATTGTGCACAGAAAATTTCACCCGCATCCTGGACAGTTTGCTCGATGGTTATGAC
AACAGGCTGCGTCCTGGATTTGGGGGTCCTGTTACAGAAGTGAAAACTGACATATATGTC
ACCAGCTTTGGACCTGTTTCTGATGTTGAAATGGAATACACAATGGATGTGTTCTTCAGG
CAGACATGGATTGACAAAAGATTAAAATATGACGGCCCCATTGAAATTTTGAGATTGAAC
AATATGATGGTAACGAAAGTGTGGACCCCTGATACTTTCTTCAGGAATGGAAAGAAATCT
GTCTCACATAATATGACAGCTCCAAATAAGCTTTTTAGAATTATGAGAAATGGTACTATT
TTATACACAATGAGACTCACCATAAGTGCGGAGTGTCCCATGAGATTGGTGGATTTTCCC
ATGGATGGTCATGCATGCCCTTTGAAATTCGGGAGTTATGCCTATCCAAAGAGTGAGATG
ATCTATACCTGGACAAAAGGTCCTGAGAAATCAGTTGAAGTTCCGAAGGAGTCTTCCAGC
TTAGTTCAATATGATTTGATTGGGCAAACCGTATCAAGTGAAACCATCAAATCAATTACG
GGTGAATATATTGTTATGACGGTTTACTTCCACCTCAGACGGAAGATGGGTTATTTTATG
ATTCAGACCTATATTCCGTGCATTATGACAGTGATTCTTTCTCAAGTTTCATTTTGGATA
AATAAAGAATCAGTTCCCGCTAGGACTGTATTTGGAATAACAACTGTCCTCACCATGACC
ACACTAAGCATCAGTGCACGACATTCTTTGCCCAAAGTGTCCTATGCTACCGCCATGGAC
TGGTTCATAGCTGTCTGCTTTGCTTTTGTATTTTCGGCCCTTATCGAGTTTGCTGCTGTC
AACTATTTCACCAATATTCAAATGGAAAAAGCCAAAAGGAAGACATCAAAGCCCCCTCAG
GAAGTTCCCGCTGCTCCAGTGCAGAGAGAGAAGCATCCTGAAGCCCCTCTGCAGAATACA
AATGCCAATTTGAACATGAGAAAAAGAACAAATGCTTTGGTTCACTCTGAATCTGATGTT
GGCAACAGAACTGAGGTGGGAAACCATTCAAGCAAATCTTCCACAGTTGTTCAAGAATCT
TCTAAAGGCACACCTCGGTCTTACTTAGCTTCCAGTCCAAACCCATTCAGCCGTGCAAAT
GCAGCTGAAACCATATCTGCAGCAAGAGCACTTCCATCTGCTTCTCCTACTTCTATCCGA
ACTGGATATATGCCTCGAAAGGCTTCAGTTGGATCTGCTTCTACTCGTCACGTGTTTGGA
TCAAGACTGCAGAGGATAAAGACCACAGTTAATACCATAGGGGCTACTGGGAAGTTGTCA
GCTACTCCTCCTCCATCGGCTCCACCACCTTCTGGATCTGGCACAAGTAAAATAGACAAA
TATGCCCGTATTCTCTTTCCAGTCACATTTGGGGCATTTAACATGGTTTATTGGGTTGTT
TATTTATCTAAGGACACTATGGAGAAATCAGAAAGTCTAATGTAA
Chromosome Location
4
Locus
4p12
External Identifiers
ResourceLink
UniProtKB IDP48169
UniProtKB Entry NameGBRA4_HUMAN
GenBank Protein ID905393
GenBank Gene IDU30461
GenAtlas IDGABRA4
HGNC IDHGNC:4078
General References
  1. Yang W, Drewe JA, Lan NC: Cloning and characterization of the human GABAA receptor alpha 4 subunit: identification of a unique diazepam-insensitive binding site. Eur J Pharmacol. 1995 Nov 30;291(3):319-25. [PubMed:8719416]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. McLean PJ, Farb DH, Russek SJ: Mapping of the alpha 4 subunit gene (GABRA4) to human chromosome 4 defines an alpha 2-alpha 4-beta 1-gamma 1 gene cluster: further evidence that modern GABAA receptor gene clusters are derived from an ancestral cluster. Genomics. 1995 Apr 10;26(3):580-6. [PubMed:7607683]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01544Flunitrazepamapproved, illicityesagonistDetails
DB00371Meprobamateapproved, illicityesagonistDetails
DB00683Midazolamapproved, illicityespotentiatorDetails
DB00690Flurazepamapproved, illicit, investigationalyespotentiatorDetails
DB05087GanaxoloneinvestigationalunknownDetails
DB00842OxazepamapprovedyespotentiatorDetails
DB00231Temazepamapproved, investigationalyespotentiatorDetails
DB01558Bromazepamapproved, illicit, investigationalyespotentiatorDetails
DB01595NitrazepamapprovedyespotentiatorDetails
DB00897Triazolamapproved, investigationalyespotentiatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespotentiatorDetails
DB01351Amobarbitalapproved, illicityespotentiatorDetails
DB00241Butalbitalapproved, illicityespotentiatorDetails
DB00306Talbutalapproved, illicityespotentiatorDetails
DB00418Secobarbitalapproved, vet_approvedyespotentiatorDetails
DB00463MetharbitalwithdrawnyespotentiatorDetails
DB00599Thiopentalapproved, vet_approvedyespotentiatorDetails
DB00794Primidoneapproved, vet_approvedyespotentiatorDetails
DB00849MethylphenobarbitalapprovedyespotentiatorDetails
DB01352Aprobarbitalexperimental, illicityespotentiatorDetails
DB01353Butethalapproved, illicityespotentiatorDetails
DB01354HeptabarbitalexperimentalyespotentiatorDetails
DB01355HexobarbitalexperimentalyespotentiatorDetails
DB01483BarbitalillicityespotentiatorDetails
DB01496Barbituric acid derivativeexperimental, illicityespotentiatorDetails
DB00898EthanolapprovedunknownDetails
DB01189Desfluraneapprovedyespositive allosteric modulatorDetails
DB00659Acamprosateapproved, investigationalyespositive modulatorDetails
DB00404Alprazolamapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00237Butabarbitalapproved, illicityespositive allosteric modulatorDetails
DB00475Chlordiazepoxideapproved, illicit, investigationalyespositive allosteric modulatorDetails
DB00349Clobazamapproved, illicityespositive allosteric modulatorDetails
DB01068Clonazepamapproved, illicityespositive allosteric modulatorDetails
DB00628Clorazepic acidapproved, illicityespositive allosteric modulatorDetails
DB00186Lorazepamapprovedyespositive allosteric modulatorDetails
DB00189Ethchlorvynolapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00228Enfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00231Temazepamapproved, investigationalyespositive allosteric modulatorDetails
DB00241Butalbitalapproved, illicityespositive allosteric modulatorDetails
DB00273Topiramateapprovedyespositive allosteric modulatorDetails
DB00292Etomidateapprovedyespositive allosteric modulatorDetails
DB00306Talbutalapproved, illicityespositive allosteric modulatorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00371Meprobamateapproved, illicityespositive allosteric modulatorDetails
DB00402Eszopicloneapproved, investigationalyespositive allosteric modulatorDetails
DB00463Metharbitalwithdrawnyespositive allosteric modulatorDetails
DB00753Isofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00794Primidoneapproved, vet_approvedyespositive allosteric modulatorDetails
DB00801Halazepamapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB00818Propofolapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedyespositive allosteric modulatorDetails
DB00842Oxazepamapprovedyespositive allosteric modulatorDetails
DB00897Triazolamapproved, investigationalyespositive allosteric modulatorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedyespositive allosteric modulatorDetails
DB01107Methyprylonapproved, illicit, withdrawnyespositive allosteric modulatorDetails
DB01159Halothaneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01205Flumazenilapprovedyespositive allosteric modulatorDetails
DB01215Estazolamapproved, illicityespositive allosteric modulatorDetails
DB01236Sevofluraneapproved, vet_approvedyespositive allosteric modulatorDetails
DB01437Glutethimideapproved, illicityespositive allosteric modulatorDetails
DB01588Prazepamapproved, illicityespositive allosteric modulatorDetails
DB01589Quazepamapproved, illicityespositive allosteric modulatorDetails
DB00543AmoxapineapprovedunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownantagonistDetails
DB11582ThiocolchicosideexperimentalyesantagonistDetails
DB09118Stiripentolapprovedyesagonistpositive allosteric modulatorDetails
DB01956Taurineapproved, nutraceuticalyesagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11901Apalutamideapproved, investigationalunknownantagonistDetails
DB06579Adipiploninvestigationalyespartial agonistDetails
DB139835,7,2′-trihydroxy-6,8-dimethoxyflavoneexperimentalunknownligandDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails