Calcium signal-modulating cyclophilin ligand

Details

Name
Calcium signal-modulating cyclophilin ligand
Synonyms
  • CAML
Gene Name
CAMLG
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016072|Calcium signal-modulating cyclophilin ligand
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEE
SQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKP
PECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
TTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKT
TVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
Number of residues
296
Molecular Weight
32952.255
Theoretical pI
8.19
GO Classification
Processes
defense response / epidermal growth factor receptor signaling pathway / receptor recycling / signal transduction / viral process
Components
endoplasmic reticulum / integral component of membrane / membrane
General Function
Not Available
Specific Function
Likely involved in the mobilization of calcium as a result of the TCR/CD3 complex interaction. Binds to cyclophilin B.
Pfam Domain Function
Transmembrane Regions
190-210 241-257
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0016073|Calcium signal-modulating cyclophilin ligand (CAMLG)
ATGGAGTCGATGGCCGTCGCTACCGACGGCGGGGAGAGGCCGGGGGTCCCAGCGGGCTCA
GGTCTGTCGGCTTCCCAGCGTCGGGCGGAGCTGCGTCGGAGAAAGCTGCTCATGAACTCG
GAACAGCGCATCAACCGGATCATGGGCTTTCACAGGCCCGGGAGCGGCGCGGAAGAAGAA
AGTCAAACAAAATCAAAGCAGCAGGACAGTGATAAACTGAACTCCCTCAGCGTTCCTTCC
GTTTCAAAGCGAGTAGTGCTGGGTGATTCAGTCAGTACAGGAACAACTGACCAGCAGGGT
GGTGTGGCCGAGGTAAAGGGGACCCAACTGGGAGACAAATTGGACTCGTTCATTAAACCA
CCTGAGTGCAGTAGTGATGTCAACCTTGAGCTCCGGCAGCGGAACAGAGGGGACCTGACA
GCGGACTCGGTCCAGAGGGGTTCCCGCCATGGCCTAGAGCAGTACCTTTCCAGATTCGAA
GAAGCAATGAAGCTAAGGAAACAGCTGATTAGTGAAAAACCCAGTCAAGAGGATGGAAAT
ACAACAGAAGAATTTGACTCTTTTCGAATATTTAGATTGGTGGGATGTGCTCTTCTTGCT
CTTGGAGTCAGAGCTTTTGTTTGCAAATACTTGTCCATATTTGCTCCATTTCTTACTTTA
CAACTTGCGTACATGGGATTATACAAATATTTTCCCAAGAGTGAAAAGAAGATAAAGACA
ACAGTACTAACAGCTGCACTTCTATTGTCGGGAATTCCTGCCGAAGTGATAAATCGATCA
ATGGATACCTATAGCAAAATGGGCGAAGTCTTCACAGATCTCTGTGTCTACTTTTTCACT
TTTATCTTTTGTCATGAACTGCTTGATTATTGGGGCTCTGAAGTACCATGA
Chromosome Location
5
Locus
5q23
External Identifiers
ResourceLink
UniProtKB IDP49069
UniProtKB Entry NameCAMLG_HUMAN
GenBank Protein ID619670
GenBank Gene IDU18242
GenAtlas IDCAMLG
HGNC IDHGNC:1471
General References
  1. Bram RJ, Crabtree GR: Calcium signalling in T cells stimulated by a cyclophilin B-binding protein. Nature. 1994 Sep 22;371(6495):355-8. [PubMed:7522304]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Feng P, Park J, Lee BS, Lee SH, Bram RJ, Jung JU: Kaposi's sarcoma-associated herpesvirus mitochondrial K7 protein targets a cellular calcium-modulating cyclophilin ligand to modulate intracellular calcium concentration and inhibit apoptosis. J Virol. 2002 Nov;76(22):11491-504. [PubMed:12388711]
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00091Ciclosporinapproved, investigational, vet_approvedyesbinderDetails