Amyloid-like protein 1

Details

Name
Amyloid-like protein 1
Synonyms
  • APLP
Gene Name
APLP1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049893|Amyloid-like protein 1
MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLC
GRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWC
GGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEA
CSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPGTPDPSGTAVGDPSTRSWPPGSRVEGA
EDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGM
PGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALNEHFQSILQT
LEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQ
IQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKM
NPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSM
LLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP
Number of residues
650
Molecular Weight
72175.825
Theoretical pI
Not Available
GO Classification
Functions
alpha-2A adrenergic receptor binding / alpha-2B adrenergic receptor binding / alpha-2C adrenergic receptor binding / heparin binding / identical protein binding / transition metal ion binding
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / animal organ morphogenesis / apoptotic process / cell adhesion / cellular response to norepinephrine stimulus / endocytosis / negative regulation of cAMP biosynthetic process / nervous system development
Components
basement membrane / integral component of membrane / perinuclear region of cytoplasm / plasma membrane
General Function
May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding (By similarity). Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I.
Specific Function
Alpha-2a adrenergic receptor binding
Pfam Domain Function
Transmembrane Regions
581-603
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0049894|Amyloid-like protein 1 (APLP1)
ATGGGGCCCGCCAGCCCCGCTGCTCGCGGTCTAAGTCGCCGCCCGGGCCAGCCGCCGCTG
CCGCTGCTGCTGCCACTATTGCTGCTGCTTCTGCGCGCGCAGCCCGCCATCGGGAGCCTG
GCCGGTGGGAGCCCCGGCGCGGCCGAGGCCCCGGGGTCGGCCCAGGTGGCTGGACTATGC
GGGCGCCTAACCCTTCACCGGGACCTGCGCACCGGCCGCTGGGAACCAGACCCACAGCGC
TCTCGACGCTGTCTCCGGGACCCGCAGCGCGTGCTGGAGTACTGCAGACAGATGTACCCG
GAGCTGCAGATTGCACGTGTGGAGCAGGCTACGCAGGCCATCCCCATGGAGCGCTGGTGC
GGGGGTTCCCGGAGCGGCAGCTGCGCCCACCCCCACCACCAGGTTGTGCCCTTCCGCTGC
CTGCCTGGTGAATTTGTGAGTGAGGCCCTGCTGGTGCCTGAAGGCTGCCGGTTCTTGCAC
CAGGAGCGCATGGACCAATGTGAGAGTTCAACCCGGAGGCATCAGGAGGCACAGGAGGCC
TGCAGCTCCCAGGGCCTCATCCTGCACGGCTCGGGCATGCTCTTACCCTGTGGCTCGGAT
CGGTTCCGTGGTGTGGAGTATGTGTGCTGTCCCCCTCCAGGGACCCCCGACCCATCTGGG
ACAGCAGTTGGTGACCCCTCCACCCGGTCCTGGCCCCCGGGGAGCAGAGTAGAGGGGGCT
GAGGACGAGGAAGAGGAGGAATCCTTCCCACAGCCAGTAGATGATTACTTCGTGGAGCCT
CCGCAGGCTGAAGAGGAAGAGGAAACGGTCCCACCCCCAAGCTCCCATACACTTGCAGTG
GTCGGCAAAGTCACTCCCACCCCGAGGCCCACAGACGGTGTGGATATTTACTTTGGCATG
CCTGGGGAAATCAGTGAGCACGAGGGGTTCCTGAGGGCCAAGATGGACCTGGAGGAGCGT
AGGATGCGCCAGATTAATGAGGTGATGCGTGAATGGGCCATGGCAGACAACCAGTCCAAG
AACCTGCCTAAAGCCGACAGACAGGCCCTGAATGAGCACTTCCAGTCCATTCTGCAGACT
CTGGAGGAGCAGGTGTCTGGTGAGCGACAGCGCCTGGTGGAAACCCACGCCACCCGCGTC
ATCGCCCTTATCAACGACCAGCGCCGGGCTGCCTTGGAGGGCTTCCTGGCAGCCCTGCAG
GCAGATCCGCCTCAGGCGGAGCGTGTCCTGTTGGCCCTGCGGCGCTACCTGCGTGCGGAG
CAGAAGGAACAGAGGCACACGCTGCGCCACTACCAGCATGTGGCCGCCGTGGATCCCGAG
AAGGCACAGCAGATGCGCTTCCAGGTGCATACCCACCTTCAAGTGATTGAGGAGAGGGTG
AATCAGAGCCTGGGCCTGCTTGACCAGAACCCCCACCTGGCTCAGGAGCTGCGGCCCCAA
ATCCAGGAACTCCTCCACTCTGAACACCTGGGTCCCAGTGAATTGGAAGCCCCTGCCCCT
GGGGGCAGCAGCGAGGACAAGGGTGGGCTGCAGCCTCCAGATTCCAAGGATGACACCCCC
ATGACCCTTCCAAAAGGGTCCACAGAACAAGATGCTGCATCCCCTGAGAAAGAGAAGATG
AACCCGCTGGAACAGTATGAGCGAAAGGTGAATGCGTCTGTTCCAAGGGGTTTCCCTTTC
CACTCATCGGAGATTCAGAGGGATGAGCTGGCACCAGCTGGGACAGGGGTGTCCCGTGAG
GCTGTGTCGGGTCTGCTGATCATGGGAGCGGGCGGAGGCTCCCTCATCGTCCTCTCCATG
CTGCTCCTGCGCAGGAAGAAGCCCTACGGGGCTATCAGCCATGGCGTGGTGGAGGTGGAC
CCCATGCTGACCCTGGAGGAGCAGCAGCTCCGCGAACTGCAGCGGCACGGCTATGAGAAC
CCCACTTACCGCTTCCTGGAGGAACGACCCTGA
Chromosome Location
19
Locus
19q13.12
External Identifiers
ResourceLink
UniProtKB IDP51693
UniProtKB Entry NameAPLP1_HUMAN
HGNC IDHGNC:597
General References
  1. Paliga K, Peraus G, Kreger S, Durrwang U, Hesse L, Multhaup G, Masters CL, Beyreuther K, Weidemann A: Human amyloid precursor-like protein 1--cDNA cloning, ectopic expression in COS-7 cells and identification of soluble forms in the cerebrospinal fluid. Eur J Biochem. 1997 Dec 1;250(2):354-63. [PubMed:9428684]
  2. Lenkkeri U, Kestila M, Lamerdin J, McCready P, Adamson A, Olsen A, Tryggvason K: Structure of the human amyloid-precursor-like protein gene APLP1 at 19q13.1. Hum Genet. 1998 Feb;102(2):192-6. [PubMed:9521588]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Kim TW, Wu K, Xu JL, McAuliffe G, Tanzi RE, Wasco W, Black IB: Selective localization of amyloid precursor-like protein 1 in the cerebral cortex postsynaptic density. Brain Res Mol Brain Res. 1995 Aug;32(1):36-44. [PubMed:7494461]
  6. Bush AI, Pettingell WH Jr, de Paradis M, Tanzi RE, Wasco W: The amyloid beta-protein precursor and its mammalian homologues. Evidence for a zinc-modulated heparin-binding superfamily. J Biol Chem. 1994 Oct 28;269(43):26618-21. [PubMed:7929392]
  7. Tomita S, Ozaki T, Taru H, Oguchi S, Takeda S, Yagi Y, Sakiyama S, Kirino Y, Suzuki T: Interaction of a neuron-specific protein containing PDZ domains with Alzheimer's amyloid precursor protein. J Biol Chem. 1999 Jan 22;274(4):2243-54. [PubMed:9890987]
  8. Simons A, Ruppert T, Schmidt C, Schlicksupp A, Pipkorn R, Reed J, Masters CL, White AR, Cappai R, Beyreuther K, Bayer TA, Multhaup G: Evidence for a copper-binding superfamily of the amyloid precursor protein. Biochemistry. 2002 Jul 30;41(30):9310-20. [PubMed:12135352]
  9. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [PubMed:19838169]
  10. Halim A, Ruetschi U, Larson G, Nilsson J: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J Proteome Res. 2013 Feb 1;12(2):573-84. doi: 10.1021/pr300963h. Epub 2013 Jan 11. [PubMed:23234360]
  11. Lee S, Xue Y, Hu J, Wang Y, Liu X, Demeler B, Ha Y: The E2 domains of APP and APLP1 share a conserved mode of dimerization. Biochemistry. 2011 Jun 21;50(24):5453-64. doi: 10.1021/bi101846x. Epub 2011 May 26. [PubMed:21574595]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknowncofactorDetails
DB01593Zincapproved, investigationalunknowncofactorDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails