4-hydroxybenzoyl-CoA thioesterase
Details
- Name
- 4-hydroxybenzoyl-CoA thioesterase
- Synonyms
- 3.1.2.23
- Gene Name
- Not Available
- Organism
- Pseudomonas sp. (strain CBS-3)
- Amino acid sequence
>lcl|BSEQ0016806|4-hydroxybenzoyl-CoA thioesterase MARSITMQQRIEFGDCDPAGIVWFPNYHRWLDAASRNYFIKCGLPPWRQTVVERGIVGTP IVSCNASFVCTASYDDVLTIETCIKEWRRKSFVQRHSVSRTTPGGDVQLVMRADEIRVFA MNDGERLRAIEVPADYIELCS
- Number of residues
- 141
- Molecular Weight
- 16105.3
- Theoretical pI
- 7.21
- GO Classification
- Functions4-hydroxybenzoyl-CoA thioesterase activity
- General Function
- 4-hydroxybenzoyl-coa thioesterase activity
- Specific Function
- Hydrolyzes 4-hydroxybenzoate-CoA, and to a lesser extent benzoyl-CoA and 4-chlorobenzoate-CoA. Not active against aliphatic acyl-CoA thioesters, including palmitoyl-CoA, hexanoyl-CoA and acetyl-CoA.
- Pfam Domain Function
- 4HBT (PF03061)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P56653 UniProtKB Entry Name 4HBT_PSEUC - General References
- Babbitt PC, Kenyon GL, Martin BM, Charest H, Slyvestre M, Scholten JD, Chang KH, Liang PH, Dunaway-Mariano D: Ancestry of the 4-chlorobenzoate dehalogenase: analysis of amino acid sequence identities among families of acyl:adenyl ligases, enoyl-CoA hydratases/isomerases, and acyl-CoA thioesterases. Biochemistry. 1992 Jun 23;31(24):5594-604. [Article]
- Chang KH, Liang PH, Beck W, Scholten JD, Dunaway-Mariano D: Isolation and characterization of the three polypeptide components of 4-chlorobenzoate dehalogenase from Pseudomonas sp. strain CBS-3. Biochemistry. 1992 Jun 23;31(24):5605-10. [Article]
- Zhuang Z, Song F, Zhang W, Taylor K, Archambault A, Dunaway-Mariano D, Dong J, Carey PR: Kinetic, Raman, NMR, and site-directed mutagenesis studies of the Pseudomonas sp. strain CBS3 4-hydroxybenzoyl-CoA thioesterase active site. Biochemistry. 2002 Sep 17;41(37):11152-60. [Article]
- Song F, Zhuang Z, Dunaway-Mariano D: Structure-activity analysis of base and enzyme-catalyzed 4-hydroxybenzoyl coenzyme A hydrolysis. Bioorg Chem. 2007 Feb;35(1):1-10. Epub 2006 Sep 7. [Article]
- Benning MM, Wesenberg G, Liu R, Taylor KL, Dunaway-Mariano D, Holden HM: The three-dimensional structure of 4-hydroxybenzoyl-CoA thioesterase from Pseudomonas sp. Strain CBS-3. J Biol Chem. 1998 Dec 11;273(50):33572-9. [Article]
- Thoden JB, Holden HM, Zhuang Z, Dunaway-Mariano D: X-ray crystallographic analyses of inhibitor and substrate complexes of wild-type and mutant 4-hydroxybenzoyl-CoA thioesterase. J Biol Chem. 2002 Jul 26;277(30):27468-76. Epub 2002 May 7. [Article]