Dihydroneopterin aldolase
Details
- Name
- Dihydroneopterin aldolase
- Synonyms
- 4.1.2.25
- 7,8-dihydroneopterin 2'-epimerase
- 7,8-dihydroneopterin aldolase
- 7,8-dihydroneopterin epimerase
- DHNA
- Dihydroneopterin epimerase
- Gene Name
- folB
- Organism
- Staphylococcus aureus
- Amino acid sequence
>lcl|BSEQ0010898|Dihydroneopterin aldolase MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHYGEVFEE VKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVREN K
- Number of residues
- 121
- Molecular Weight
- 13750.58
- Theoretical pI
- 5.64
- GO Classification
- Functionsdihydroneopterin aldolase activity / isomerase activityProcessesfolic acid biosynthetic process / tetrahydrofolate biosynthetic process
- General Function
- Isomerase activity
- Specific Function
- Catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin. Can also catalyze the epimerization of carbon 2' of dihydroneopterin to dihydromonapterin.
- Pfam Domain Function
- FolB (PF02152)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P56740 UniProtKB Entry Name FOLB_STAAU - General References
- Hennig M, D'Arcy A, Hampele IC, Page MG, Oefner C, Dale GE: Crystal structure and reaction mechanism of 7,8-dihydroneopterin aldolase from Staphylococcus aureus. Nat Struct Biol. 1998 May;5(5):357-62. [Article]
- Sanders WJ, Nienaber VL, Lerner CG, McCall JO, Merrick SM, Swanson SJ, Harlan JE, Stoll VS, Stamper GF, Betz SF, Condroski KR, Meadows RP, Severin JM, Walter KA, Magdalinos P, Jakob CG, Wagner R, Beutel BA: Discovery of potent inhibitors of dihydroneopterin aldolase using CrystaLEAD high-throughput X-ray crystallographic screening and structure-directed lead optimization. J Med Chem. 2004 Mar 25;47(7):1709-18. [Article]
- Blaszczyk J, Li Y, Gan J, Yan H, Ji X: Structural basis for the aldolase and epimerase activities of Staphylococcus aureus dihydroneopterin aldolase. J Mol Biol. 2007 Apr 20;368(1):161-9. Epub 2007 Feb 9. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01778 8-Aminotheophylline experimental unknown Details DB01906 3-(5-amino-7-hydroxy-(1,2,3)triazolo(4,5-d)pyrimidin-2-yl)benzoic acid experimental unknown Details DB02119 6-Hydroxymethyl-7,8-Dihydropterin experimental unknown Details DB02489 9-Methylguanine experimental unknown Details DB03231 3-(5-Amino-7-oxo-3,7-dihydro-2H-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-(2-{[2-(hydroxymethyl)phenyl]sulfanyl}benzyl)benzamide experimental unknown Details DB03571 3-(5-amino-7-hydroxy-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-(3,5-dichlorobenzyl)-benzamide experimental unknown Details DB04168 Bropirimine experimental unknown Details DB04425 7,8-Dihydroneopterin experimental unknown Details DB04400 L-erythro-7,8-dihydrobiopterin experimental unknown Details DB06906 ethyl 2-amino-4-hydroxypyrimidine-5-carboxylate experimental unknown Details