50S ribosomal protein L27

Details

Name
50S ribosomal protein L27
Synonyms
Not Available
Gene Name
rpmA
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0012314|50S ribosomal protein L27
MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLF
ALVDGVVEFQDRGRLGRYVHVRPLA
Number of residues
85
Molecular Weight
9508.0
Theoretical pI
12.19
GO Classification
Functions
structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
Structural constituent of ribosome
Specific Function
Found on the solvent side of the large subunit.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012315|50S ribosomal protein L27 (rpmA)
ATGGCGCATAAAAAGGGTCTAGGTTCCACGAGGAACGGCCGCGACTCCCAGGCCAAGCGC
CTCGGGGTCAAGCGGTACGAGGGCCAGGTGGTCCGGGCGGGCAACATCCTGGTGCGCCAG
CGGGGCACCAGGTTCAAGCCCGGCAAGAACGTGGGCATGGGCCGGGACTTCACCCTCTTC
GCCCTGGTGGACGGGGTGGTGGAGTTCCAGGACCGGGGCCGTCTCGGTCGGTACGTTCAC
GTGCGCCCCTTGGCCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP60493
UniProtKB Entry NameRL27_THET8
GenBank Gene IDAP008226
General References
  1. Katsani KR, Tsiboli P, Anagnostopoulos K, Urlaub H, Choli-Papadopoulou T: Identification of the 50S ribosomal proteins from the Eubacterium Thermus thermophilus. Biol Chem. 2000 Nov;381(11):1079-87. [PubMed:11154066]
  2. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [PubMed:16287167]
  3. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [PubMed:11283358]
  4. Wang H, Takemoto CH, Murayama K, Sakai H, Tatsuguchi A, Terada T, Shirouzu M, Kuramitsu S, Yokoyama S: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8. Protein Sci. 2004 Oct;13(10):2806-10. Epub 2004 Aug 31. [PubMed:15340170]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB044471,4-DithiothreitolexperimentalunknownDetails